KEGG   Mycobacterium tuberculosis H37Rv: Rv0162c
Entry
Rv0162c           CDS       T00015                                 

Gene name
adhE1
Definition
(RefSeq) zinc-type alcohol dehydrogenase subunit E
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00071  Fatty acid degradation
mtu00350  Tyrosine metabolism
mtu00620  Pyruvate metabolism
mtu00625  Chloroalkane and chloroalkene degradation
mtu00626  Naphthalene degradation
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv0162c (adhE1)
   00620 Pyruvate metabolism
    Rv0162c (adhE1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rv0162c (adhE1)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Rv0162c (adhE1)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rv0162c (adhE1)
   00626 Naphthalene degradation
    Rv0162c (adhE1)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rv0162c (adhE1)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Other DBs
NCBI-GeneID: 886824
NCBI-ProteinID: YP_177699
TubercuList: Rv0162c
UniProt: L7N6B3
Position
complement(191984..193135)
AA seq 383 aa
MPAVQPWLYSNMPAIRGAVLDQIGVPRPYWRSKPISVVELHLDPPDRGEVLVRIEAAGVC
HSDLSVVDGTRVRPVPILLGHEAAGIVEQVGDGVDGVAVGQRVVLVFLPRCGQCAACATD
GRTPCEPGSAANKAGTLLGGGIRLSRGGRPVYHHLGVSGFATHVVVNRASVVPVPHEVPP
TVAALLGCAVLTGGGAVLNVGDPQPGQSVAVVGLGGVGMAAVLTALTYTDVRVVAVDQLP
EKLSAAKALGAHEIYTPQQATAGGVKAAVVVEAVGHPAALHTAIGLTAPGGRTITVGLPP
PDVRISLSPLDFVTEGRSLIGSYLGSAVPSHDIPRFVSLWQSGRLPVESLVTSTIRLDDI
NEAMDHLADGIAVRQLISFTGDL
NT seq 1152 nt   +upstreamnt  +downstreamnt
gtgccggcagtgcagccatggttgtattccaacatgcctgccatccggggcgcggtgcta
gaccagatcggtgtgccgcggccctattggcggtcgaaaccaatcagcgtcgtcgagctg
cacctggacccgcccgaccgcggtgaggtccttgtccgaatcgaggctgcgggcgtgtgc
cactccgacctgtcggtggtcgacggcacccgggtacggccggtgccgatcttgctcggt
catgaagccgctggaatcgtcgagcaggtcggcgacggcgtcgacggggtcgcggtcggt
cagcgagtcgtgctggtgttccttccgcgttgcggccagtgcgcggcgtgcgcgaccgac
ggtcggacgccgtgcgaaccgggcagcgcggccaacaaggccggcacactgctcggtggc
ggtatccggctcagccggggcggccgcccggtgtaccaccacctcggcgtctcgggtttc
gcgacccatgtcgtcgtcaaccgggccagcgtggttccggtgccgcacgaggtgccgccc
accgtcgctgccctactcgggtgcgcggtgctcaccggtgggggtgcggtactcaacgtc
ggtgatccgcagcccggccagtcggtcgccgtcgtcggcctcgggggcgtcggtatggca
gcggtgctcaccgctttgacgtatacagacgttcgtgtggtcgccgtcgatcagctaccc
gaaaagctgtcggccgcaaaggccttgggcgcccatgagatctacacaccgcagcaggcc
acggccggcggggtcaaagccgccgtggttgtcgaagccgtcggtcatcctgccgcgctg
cacaccgcgatcgggcttaccgcgcccggagggcgcaccatcaccgtcgggttgccgcca
ccggatgtccggatcagcttgtcgccgttggattttgtcaccgaaggccggtcactgatc
ggcagctatctgggttcggcggtgcccagccacgacattccccgcttcgtgtcgttgtgg
caatcgggccgtctgccggtggagtcgctggtgacgtcaacgattcggttggacgatatc
aacgaggcgatggaccacctcgccgatggcatcgcggtgcgtcagctcatcagtttcacc
ggtgatctctaa

KEGG   Mycobacterium tuberculosis H37Rv: Rv0761c
Entry
Rv0761c           CDS       T00015                                 

Gene name
adhB
Definition
(RefSeq) alcohol dehydrogenase B
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00071  Fatty acid degradation
mtu00350  Tyrosine metabolism
mtu00620  Pyruvate metabolism
mtu00625  Chloroalkane and chloroalkene degradation
mtu00626  Naphthalene degradation
mtu00680  Methane metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01200  Carbon metabolism
mtu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv0761c (adhB)
   00620 Pyruvate metabolism
    Rv0761c (adhB)
  09102 Energy metabolism
   00680 Methane metabolism
    Rv0761c (adhB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rv0761c (adhB)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Rv0761c (adhB)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rv0761c (adhB)
   00626 Naphthalene degradation
    Rv0761c (adhB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rv0761c (adhB)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     Rv0761c (adhB)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N NADH_4Fe-4S PFK Fer4_12
Other DBs
NCBI-GeneID: 888738
NCBI-ProteinID: YP_177754
TubercuList: Rv0761c
UniProt: P9WQC7
Position
complement(854699..855826)
AA seq 375 aa
MKTKGALIWEFNQPWSVEEIEIGDPRKDEVKIQMEAAGMCRSDHHLVTGDIPMAGFPVLG
GHEGAGIVTEVGPGVDDFAPGDHVVLAFIPSCGKCPSCQAGMRNLCDLGAGLLAGESVTD
GSFRIQARGQNVYPMTLLGTFSPYMVVHRSSVVKIDPSVPFEVACLVGCGVTTGYGSAVR
TADVRPGDDVAIVGLGGVGMAALQGAVSAGARYVFAVEPVEWKRDQALKFGATHVYPDIN
AALMGIAEVTYGLMAQKVIITVGKLDGADVDSYLTITAKGGTCVLTAIGSLVDTQVTLNL
AMLTLLQKNIQGTIFGGGNPHYDIPKLLSMYKAGKLNLDDMVTTAYKLEQINDGYQDMLN
GKNIRGVIRYTDDDR
NT seq 1128 nt   +upstreamnt  +downstreamnt
gtgaagaccaagggcgcactgatctgggagttcaaccagccatggtccgtcgaagagatc
gaaatcggcgacccgcgcaaggacgaagtcaagatccagatggaagcggctgggatgtgc
cgctccgaccatcacctggtgacgggcgacatcccgatggcgggctttcccgttctgggc
ggacacgagggcgcgggcatcgtcaccgaggtcggcccgggagtcgacgacttcgccccg
ggcgatcacgtggtgttggcattcatcccgtcctgcggcaagtgtccgtcctgccaggct
ggaatgcggaatctgtgcgacctgggggcggggctgctcgccggggaatctgtgacggac
ggctccttccggattcaggctcgcggccagaacgtctacccgatgaccctgctcggaacg
ttttcaccgtacatggtggtgcaccgcagctcggtggtgaagatcgacccgtcggtgccc
ttcgaagtcgcctgcctggttggttgcggcgtcaccaccggctatggttcggcggtccgc
acggccgacgtccggccgggcgacgacgtggccatcgtcggcttgggtggggtcggcatg
gcggcgttgcagggcgcggtcagcgcgggcgcccgctacgtcttcgcggtggagccggtg
gaatggaaacgtgatcaggctctgaaattcggtgccacccacgtctacccggacatcaac
gccgcgctgatgggcattgccgaggtcacctacggcctgatggcgcagaaggtgatcatc
accgtcggcaagctcgatggcgccgacgtcgacagctatctgaccatcacggccaagggc
ggcacctgcgtgctgacggccatcggcagcctggtcgacacccaggtgacgctgaacctc
gcgatgttgaccctgctgcaaaagaacatccagggcaccatcttcggcggcggcaacccg
cactacgacattccgaagctgttgtcgatgtataaggccggcaaactcaacctcgacgac
atggtgaccactgcgtacaagctggagcagatcaacgacggataccaggacatgctgaac
ggcaagaacattcgcggcgtgatccggtacacggacgacgaccgctag

KEGG   Mycobacterium tuberculosis H37Rv: Rv1530
Entry
Rv1530            CDS       T00015                                 

Gene name
adh
Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00071  Fatty acid degradation
mtu00350  Tyrosine metabolism
mtu00620  Pyruvate metabolism
mtu00625  Chloroalkane and chloroalkene degradation
mtu00626  Naphthalene degradation
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1530 (adh)
   00620 Pyruvate metabolism
    Rv1530 (adh)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rv1530 (adh)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Rv1530 (adh)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rv1530 (adh)
   00626 Naphthalene degradation
    Rv1530 (adh)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rv1530 (adh)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C DapB_N GHMP_kinases_C
Other DBs
NCBI-GeneID: 886426
NCBI-ProteinID: NP_216046
TubercuList: Rv1530
UniProt: P9WQC3
Position
1731373..1732476
AA seq 367 aa
MSDGAVVRALVLEAPRRLVVRQYRLPRIGDDDALVRVEACGLCGTDHEQYTGELAGGFAF
VPGHETVGTIAAIGPRAEQRWGVSAGDRVAVEVFQSCRQCANCRGGEYRRCVRHGLADMY
GFIPVDREPGLWGGYAEYQYLAPDSMVLRVAGDLSPEVATLFNPLGAGIRWGVTIPETKP
GDVVAVLGPGIRGLCAAAAAKGAGAGFVMVTGLGPRDADRLALAAQFGADLAVDVAIDDP
VAALTEQTGGLADVVVDVTAKAPAAFAQAIALARPAGTVVVAGTRGVGSGAPGFSPDVVV
FKELRVLGALGVDATAYRAALDLLVSGRYPFASLPRRCVRLEGAEDLLATMAGERDGVPP
IHGVLTP
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtcggacggcgcggtggtacgggcattggtattggaggcgccgcgcaggctggtcgtg
cgccagtaccggctgccgcgcatcggcgatgatgacgcactagtgcgagtagaggcctgc
gggctgtgcggcaccgatcacgagcaatacacgggcgagctggccggtgggtttgccttc
gtacctggccacgagacggtcgggacgattgcggccatcggtccgcgggcggagcagcgg
tggggcgtgtcggccggcgaccgagtagccgtcgaggtattccagtcgtgtcggcagtgc
gctaactgtcgtggcggcgagtaccggcgttgtgtacggcatggcctcgctgacatgtac
gggttcatcccggttgaccgagagcctggcctgtggggcggttacgccgaatatcagtac
ctggcgccggattcgatggtgttgcgggtggccggtgacctcagcccggaagtggccacc
ttgttcaacccgctgggggcgggaatacgttggggagtaacgattcccgaaaccaaaccg
ggcgacgtcgtggcggtgctgggtccaggaatccgggggctgtgcgccgccgcggcggca
aaaggggccggtgccgggttcgtgatggtgaccgggttgggaccccgtgacgccgaccgg
ttggcgctggcggcacagttcggagccgacctcgccgtcgatgttgcgatcgatgacccg
gtcgccgccctgaccgaacagaccggtgggctggcagacgtcgttgtcgacgtgaccgcc
aaggcgccagcggcattcgcacaggcgatagcgctagcccggcccgccgggaccgttgtt
gtcgccggcacccggggcgtgggcagcggggcaccgggattttcgcccgacgtcgttgtg
ttcaaggagctgcgtgtgcttggcgccctcggcgtagacgccaccgcctaccgggccgcg
cttgatctgttggtgtccggtcgataccccttcgcaagcctgcctcgccgctgcgtgcgg
ctcgaaggcgccgaggatctgctggctaccatggccggtgaacgcgacggtgtcccgcct
atccacggagtgctcacaccatga

KEGG   Mycobacterium tuberculosis H37Rv: Rv1862
Entry
Rv1862            CDS       T00015                                 

Gene name
adhA
Definition
(RefSeq) alcohol dehydrogenase A
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00071  Fatty acid degradation
mtu00350  Tyrosine metabolism
mtu00620  Pyruvate metabolism
mtu00625  Chloroalkane and chloroalkene degradation
mtu00626  Naphthalene degradation
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1862 (adhA)
   00620 Pyruvate metabolism
    Rv1862 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rv1862 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Rv1862 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rv1862 (adhA)
   00626 Naphthalene degradation
    Rv1862 (adhA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rv1862 (adhA)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Other DBs
NCBI-GeneID: 885652
NCBI-ProteinID: NP_216378
TubercuList: Rv1862
UniProt: P9WQC1
Position
2109544..2110584
AA seq 346 aa
MVSPATTATMSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGVCRTDLHVTEG
DLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDRGDRVGIAWLRHTCGVCKYCRRGSE
NLCPQSRYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRTELP
PGGRLGLYGFGGSAHITAQVALAQGAEIHVMTRGARARKLALQLGAASAQDAADRPPVPL
DAAILFAPVGDLVLPALEALDRGGILAIAGIHLTDIPDLNYQQHLFQERQIRSVTSNTRA
DARAFFDFAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVLLI
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggtctcaccggcgaccacggcgacgatgagtgcgtggcaggtgcgtcggcccggcccg
atggacaccggcccgctcgaacgagtgaccacccgggtgccgcgcccggcgccatcggag
ttgctggtggccgtgcacgcatgcggggtgtgccgcaccgatctccacgtgaccgaaggt
gacctgcccgtgcaccgcgaacgggtgattcccggccacgaggtagtgggagaggtcatt
gaggtgggctcagcggtgggcgcggctgccggtggcgaattcgaccgaggagaccgggtg
ggtatcgcctggctgcgtcacacttgcggggtctgcaagtactgccggcgcggcagcgag
aacctctgcccgcaatcccgctacaccggctgggacgccgacgggggatacgccgaattc
acgacggttcctgcggctttcgcgcaccatctgccgagcggctatagcgacagcgagctg
gcgccgttgttgtgcgccggcatcatcggatatcgatcgctgctgcgcaccgagctacca
cccggtggccggctgggtctctacggattcggcggcagtgcccacatcaccgcccaggtc
gcgttggcgcaaggcgccgaaatacatgtgatgacacgcggggcccgcgcgcgcaagctg
gcgctgcaacttggcgctgcatcggctcaggacgccgccgaccggccacccgtgccgctg
gacgccgcgatcttattcgccccggtcggggatctggtgctgcccgcgctggaagcgctg
gaccgtggcggcatcttggcgatcgccgggatccacctgacagatattccggacctgaac
taccagcagcacttgttccaggagcgtcagatccggtcggtcacgtcgaacacccgcgcc
gatgcgcgcgcgttcttcgacttcgccgcccagcatcacatcgaggtcaccacgccggag
tacccgcttggccaagccgatcgtgcgctgggcgacctgagcgccggccgcatcgccggt
gccgccgtgctgctgatctga

DBGET integrated database retrieval system