KEGG   Mycobacterium tuberculosis H37Rv: Rv0488Help
Entry
Rv0488            CDS       T00015                                 

Definition
(RefSeq) amino acid transporter
  KO
K06895  L-lysine exporter family protein LysE/ArgO
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv0488
Transporters [BR:mtu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Rv0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE
Motif
Other DBs
NCBI-GeneID: 887171
NCBI-ProteinID: NP_215002
TubercuList: Rv0488
UniProt: P9WK33
Position
577664..578269
Genome map
AA seq 201 aa AA seqDB search
MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLV
ARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCLVVTFLNPHVYLDTVVL
IGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFATPAAWRILDALVAVTMIG
VAVVVLVTSPSVPTANVALII
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgctcaaggtcgcgatcggcccgcaaaacgcatttgtcctgcgccaaggaatt
aggcgagaatacgtgctggtcattgtggcgctgtgcgggatcgctgatggggcactgatt
gccgcgggcgttggcggcttcgctgcgctgattcacgctcatcccaatatgactttggtt
gcccgatttggcggcgcagcgttcttgattggctacgcgctattggccgcgcggaacgcg
tggcgcccgagcgggctggtgccgtcggaatcggggccggctgcgctgatcggcgtggtg
caaatgtgcctggtggtgacctttctcaacccacacgtctatctggacactgtggtgttg
atcggtgccctcgccaatgaggaatcagatctgcggtggtttttcggagccggtgcctgg
gccgccagcgtcgtatggttcgccgtgttgggatttagcgcgggccggctacagccattc
ttcgcaactccagctgcttggcgcattcttgatgcgctggttgccgtgacgatgattggg
gtcgccgtcgttgtgctcgtcacgtcaccaagtgtgccgacggccaatgtcgcactgatc
atttga

DBGET integrated database retrieval system