KEGG   Mycobacterium tuberculosis H37Rv: Rv0764cHelp
Entry
Rv0764c           CDS       T00015                                 

Gene name
cyp51
Definition
(RefSeq) lanosterol 14-alpha demethylase
  KO
K05917  sterol 14alpha-demethylase [EC:1.14.14.154 1.14.15.36]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00100  Steroid biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    Rv0764c (cyp51)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mtu00199]
    Rv0764c (cyp51)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.154  sterol 14alpha-demethylase
     Rv0764c (cyp51)
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.36  sterol 14alpha-demethylase (ferredoxin)
     Rv0764c (cyp51)
Cytochrome P450 [BR:mtu00199]
 Cytochrome P450, animal type
  CYP51 family
   Rv0764c (cyp51)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 888819
NCBI-ProteinID: NP_215278
TubercuList: Rv0764c
UniProt: P9WPP9
Structure
PDB: 

Position
complement(856682..858037)
Genome map
AA seq 451 aa AA seqDB search
MSAVALPRVSGGHDEHGHLEEFRTDPIGLMQRVRDECGDVGTFQLAGKQVVLLSGSHANE
FFFRAGDDDLDQAKAYPFMTPIFGEGVVFDASPERRKEMLHNAALRGEQMKGHAATIEDQ
VRRMIADWGEAGEIDLLDFFAELTIYTSSACLIGKKFRDQLDGRFAKLYHELERGTDPLA
YVDPYLPIESFRRRDEARNGLVALVADIMNGRIANPPTDKSDRDMLDVLIAVKAETGTPR
FSADEITGMFISMMFAGHHTSSGTASWTLIELMRHRDAYAAVIDELDELYGDGRSVSFHA
LRQIPQLENVLKETLRLHPPLIILMRVAKGEFEVQGHRIHEGDLVAASPAISNRIPEDFP
DPHDFVPARYEQPRQEDLLNRWTWIPFGAGRHRCVGAAFAIMQIKAIFSVLLREYEFEMA
QPPESYRNDHSKMVVQLAQPACVRYRRRTGV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgttgcactaccccgggtttcgggtggccacgacgaacacggccacctcgag
gagttccgcaccgatccgatcgggctgatgcaacgggtccgcgacgaatgcggagacgtc
ggtaccttccagctggccgggaagcaggtcgtgctgctgtccggctcgcacgccaacgaa
ttcttcttccgggcgggcgacgacgacctggaccaggccaaggcatacccgttcatgacg
ccgatcttcggcgagggcgtggtgttcgacgccagcccggaacggcgtaaagagatgctg
cacaatgccgcgctacgcggcgagcagatgaagggccacgctgccaccatcgaagatcaa
gtccgacggatgatcgccgactggggtgaggccggcgagatcgatctgctggacttcttc
gccgagctgaccatctacacctcctcggcctgcctgatcggcaagaagttccgcgaccag
ctcgacgggcgattcgccaagctctatcacgagttggagcgcggcaccgacccactagcc
tacgtcgacccgtatctgccgatcgagagcttccgtcgccgcgacgaagcccgcaatggt
ctggtggcactggttgcggacatcatgaacggccggatcgccaacccacccaccgacaag
agcgaccgtgacatgctcgacgtgctcatcgccgtcaaggctgagaccggcactccccgg
ttctcggccgacgagatcaccggcatgttcatctcgatgatgttcgccggccatcacacc
agctcgggtacggcttcgtggacgctgatcgagttgatgcgccatcgcgacgcctacgcg
gccgtgatcgacgaactcgacgagctgtacggcgacggccgatcggtgagtttccatgcg
ctgcgccagattccgcagctggaaaacgtgctgaaagagacgctgcgcctgcaccctccg
ctgatcatcctcatgcgagtggccaagggcgagttcgaggtgcaaggccaccggattcat
gagggcgatctggtggcggcctccccggcgatctccaaccggatccccgaagacttcccc
gatccccacgacttcgtgccagcacgatacgagcagccgcgccaggaagatctgctcaac
cgctggacgtggattccgttcggcgccggccggcatcgttgcgtgggggcggcgttcgcc
atcatgcagatcaaagcgatcttctcggtgttgttgcgcgagtatgagtttgagatggcg
caaccgccagaaagctatcgtaacgaccattcgaagatggtggtgcagttggcccagccc
gcttgcgtgcgctaccgccggcgaacgggagtttaa

DBGET integrated database retrieval system