KEGG   Mycobacterium tuberculosis H37Rv: Rv1106c
Entry
Rv1106c           CDS       T00015                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase
  KO
K16045  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00984  Steroid degradation
mtu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Rv1106c
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     Rv1106c
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     Rv1106c
SSDB
Motif
Pfam: 3Beta_HSD Epimerase GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 KR NmrA adh_short
Other DBs
NCBI-GeneID: 886004
NCBI-ProteinID: NP_215622
TubercuList: Rv1106c
UniProt: P9WQP7
Position
complement(1232844..1233956)
AA seq 370 aa
MLRRMGDASLTTELGRVLVTGGAGFVGANLVTTLLDRGHWVRSFDRAPSLLPAHPQLEVL
QGDITDADVCAAAVDGIDTIFHTAAIIELMGGASVTDEYRQRSFAVNVGGTENLLHAGQR
AGVQRFVYTSSNSVVMGGQNIAGGDETLPYTDRFNDLYTETKVVAERFVLAQNGVDGMLT
CAIRPSGIWGNGDQTMFRKLFESVLKGHVKVLVGRKSARLDNSYVHNLIHGFILAAAHLV
PDGTAPGQAYFINDAEPINMFEFARPVLEACGQRWPKMRISGPAVRWVMTGWQRLHFRFG
FPAPLLEPLAVERLYLDNYFSIAKARRDLGYEPLFTTQQALTECLPYYVSLFEQMKNEAR
AEKTAATVKP
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcttcgccgcatgggtgatgcatcgctgacaaccgagctcggccgcgttctggtcacc
ggcggcgcgggcttcgtgggcgccaacctggtgaccaccttgctggaccgcgggcactgg
gtgcgttccttcgaccgcgcgccgtcgctgttgcctgcgcatccgcaactggaggtgctg
caaggggacatcaccgacgcggacgtctgcgccgcggccgtggacggcatcgacacgatc
ttccacaccgcagcgatcatcgagctgatgggcggcgcgtcggtcaccgacgagtaccgc
caacgtagctttgcggtcaacgtcggcggcaccgagaacctgctgcacgccggccagcgg
gccggggtgcagcggttcgtctacacgtcatccaacagtgtggtgatgggcggccagaac
atcgccggcggtgacgagacgctgccctataccgaccggttcaacgacctctacaccgag
accaaggtggttgccgagcgattcgtgttggcccagaacggtgtcgacggcatgctgacg
tgcgcgatccggcccagcggcatctggggaaacggcgatcagacgatgttccgcaagctg
ttcgaaagtgtgctcaagggccacgtcaaggtgctggtcgggcgcaagtcggcccggctg
gataactcttacgtgcacaacctgattcacggtttcatcttggccgctgcccatctggtg
ccggacggcacagcgcccgggcaggcttacttcatcaacgacgcagagccgatcaatatg
ttcgagttcgctcggccggtgctcgaggcgtgcgggcagcgctggccgaagatgcggatt
tccggccccgcggtccgctgggtaatgacggggtggcagcggctgcacttccggttcgga
ttccccgcgccgctgctcgagccgctggccgtcgaacgactgtacctggacaactacttt
tcgatcgctaaggcacgccgcgacctgggctatgagccgctgttcaccacccagcaggcg
ctgaccgaatgcctgccgtactacgtgagtctgtttgagcagatgaagaacgaggcccgg
gcggaaaaaacggccgccacagtcaagccgtag

DBGET integrated database retrieval system