KEGG   Mycobacterium tuberculosis H37Rv: Rv1170
Entry
Rv1170            CDS       T00015                                 

Gene name
mshB
Definition
(RefSeq) 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase
  KO
K15525  N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase [EC:3.5.1.103]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rv1170 (mshB)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.103  N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase
     Rv1170 (mshB)
SSDB
Motif
Pfam: PIG-L Glyco_transf_4
Other DBs
NCBI-GeneID: 885997
NCBI-ProteinID: NP_215686
TubercuList: Rv1170
UniProt: P9WJN3
Structure
PDB: 
1Q74 4EWL 1Q7T

Position
1300304..1301215
AA seq 303 aa
MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADH
ADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGA
LVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKF
YWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAA
LAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTA
SGT
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtctgagacgccgcggctgctgtttgttcatgcacaccccgacgatgagagcctgagc
aacggcgcaaccatcgcgcactacacctcccgtggcgcacaggtccatgtcgtcacgtgc
accctgggtgaggagggcgaggtcattggcgatcgctgggctcaactcaccgccgatcat
gcggaccaactcggtggctaccgcatcggcgagctcaccgcggcgttgcgagcgctcggg
gtcagcgcaccgatctaccttggcggcgcgggtcgctggcgcgactccggcatggccggc
acagaccagcggagtcagcggagattcgtcgatgctgacccccggcagaccgtcggggca
ttggtcgcgatcattcgcgagctgcggccgcatgtcgtggtgacctatgaccccaatggc
ggttacggtcatcctgaccacgtgcacacccacaccgtcactaccgccgcggtggccgca
gcgggtgttgggtccggtaccgcagatcaccccggcgacccgtggacggtgccgaagttc
tactggacggtcttgggtctgagcgcgctcatttcgggcgcgcgagccctggtccccgac
gatctgcgacccgaatgggtgttgccgcgggccgacgagattgcattcgggtactccgac
gacggtatcgacgccgtcgtcgaggccgatgagcaggcgcgagccgccaaggttgcggca
ctggctgcccatgccacccaagttgtcgtcggcccgaccggccgggccgccgccttgtcg
aacaacctggcactgcccatcctggccgatgagcattacgtgctcgccggcggctccgcg
ggcgcccgcgatgaacgtggctgggaaactgatctgctcgccggtctgggcttcaccgcg
tccggcacgtag

DBGET integrated database retrieval system