KEGG   Mycobacterium tuberculosis H37Rv: Rv1209Help
Entry
Rv1209            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIVA
Motif
Other DBs
NCBI-GeneID: 887600
NCBI-ProteinID: NP_215725
TubercuList: Rv1209
UniProt: O05310 L0T7L7
Position
1353157..1353525
Genome map
AA seq 122 aa AA seqDB search
MALVLVYLVVLVLVAIVLFAAASLLFGRGEQLPPLPRATTATTLPAFGVTRADVDAVKFT
QVLRGYKTSEVDWVLERLGRELEALRSQLGAIHASSEDAEAESDASNPSRGETVVHYRSD
PA
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttggtgttggtgtacctggtggtgctggtcctggtggcgatcgtgctgttcgct
gcggcgagcttgctattcggccgtggcgagcagttgccgcccctgccgcgggcgacgacg
gcgacgacgctgccggcgttcggggtcacccgcgccgacgtcgacgcggtcaagttcacg
caggtgctgcgcgggtacaagaccagcgaggtggactgggtgctggaacggctcggccgt
gagctcgaggcgctacgctctcagctcggggcgatccacgcctcgtcggaagacgccgag
gccgagtctgacgcgtcaaacccttcgcgcggcgagaccgtcgtgcactaccgttctgac
cccgcgtga

DBGET integrated database retrieval system