KEGG   Mycobacterium tuberculosis H37Rv: Rv1211Help
Entry
Rv1211            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3117
Motif
Other DBs
NCBI-GeneID: 887990
NCBI-ProteinID: NP_215727
TubercuList: Rv1211
UniProt: O05312
Position
1354243..1354470
Genome map
AA seq 75 aa AA seqDB search
MLGADQARAGGPARIWREHSMAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTP
DEAAALGDELKGVTS
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcgccgaccaggctcgcgcaggcgggccagcccgaatctggagggagcactca
atggcggcgatgaagccccggaccggcgacggtcctttggaagcaactaaggaggggcgc
ggcattgtgatgcgagtaccacttgagggtggcggtcgcctggtcgtcgagctgacaccc
gacgaagccgccgcactgggtgacgaactcaaaggcgttactagctaa

DBGET integrated database retrieval system