KEGG   Mycobacterium tuberculosis H37Rv: Rv1227cHelp
Entry
Rv1227c           CDS       T00015                                 

Definition
(RefSeq) transmembrane protein
  KO
K09167  uncharacterized protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Rv1227c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bPH_2
Motif
Other DBs
NCBI-GeneID: 885872
NCBI-ProteinID: NP_215743
TubercuList: Rv1227c
UniProt: O33223
Position
complement(1370292..1370825)
Genome map
AA seq 177 aa AA seqDB search
MDHARNVPSATGPQRNHLALAEPAHRPSSQAPVMWALSASLGWILPVIAQLVWWAVHPQP
PWPHLAAAALTAVAMVVHIGVVPLWRYRVHRWEISPQAVFTRTGWLVQERRITPISRVQT
VDTYRGPMDRLFGLANVTVTTASSAGAVHIEALDTDVADRVVAQLTDIAALRGEDAT
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
ttggaccatgctcgaaatgtgccaagcgcaaccggaccgcagagaaatcacctcgcgctc
gccgagccggcccatcgaccgagcagccaggcgccggtgatgtgggcgctgtccgcgtcg
ctgggctggatactcccggtgatcgcgcagctggtgtggtgggcggtgcatccccagccg
ccctggccgcacctggccgcggccgctctcaccgcggtggcgatggtggtgcacatcggg
gtggtcccgctctggcgttaccgggtacaccgttgggagatcagcccgcaggccgtattc
acccgcaccggttggctcgtgcaggagcgccgcatcacaccgatttcccgggtgcagacc
gtcgacacctaccgcggcccgatggaccggctgttcgggctggccaacgtcaccgtaacc
acggcgtcctcggcgggcgcggtgcacatcgaggcgttggacaccgacgtcgccgatcgg
gtggtggcgcagctgaccgacatcgccgcgctgcgcggcgaggacgcgacatga

DBGET integrated database retrieval system