KEGG   Mycobacterium tuberculosis H37Rv: Rv1234Help
Entry
Rv1234            CDS       T00015                                 

Definition
(RefSeq) transmembrane protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_2_1 FecCD
Motif
Other DBs
NCBI-GeneID: 887137
NCBI-ProteinID: NP_215750
TubercuList: Rv1234
UniProt: O50451 A0A089QNS6
Position
1376976..1377503
Genome map
AA seq 175 aa AA seqDB search
MTSPFQPRQVPGSTPAAAGAGRRGVPALPTPPKGWPVGSYPTYAEAQRAVDYLSEQQFPV
QQVTIVGVDLMQVERVTGRLTWPKVLGGGVLSGAWLGLFIGLVLGFFSPNPWSALVTGLV
AGVFFGLITSAVPYAMARGTRDFSSTMQLVAGRYDVLCDPQNAEKARDLLARLAI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgactagcccattccagcccagacaggttcccggttcaacacccgccgccgcaggtgcg
ggtcgacgtggtgtgcccgcattgcccaccccgccgaaaggttggccagtcgggtcgtat
cccacctatgccgaggcgcaacgtgcggtcgactatctatccgaacagcagttcccggtc
cagcaggtgaccatcgttggcgtggacctcatgcaggttgaacgggtcacaggccggctg
acctggcccaaagtgcttggtggcggcgtgctgagtggcgcctggctgggcctgttcatc
gggttggtgctcgggttcttcagtcccaatccatggtccgcgctggttaccggcctggtg
gccggggtgttcttcgggctgatcacctctgcagtgccgtacgcaatggctcgcggcaca
agggatttcagctcgaccatgcaactggttgccggtcgctacgacgtactttgtgatccg
caaaatgcggaaaaggcacgggatctgctggcgcgtctggcgatctga

DBGET integrated database retrieval system