KEGG   Mycobacterium tuberculosis H37Rv: Rv1235Help
Entry
Rv1235            CDS       T00015                                 

Gene name
lpqY
Definition
(RefSeq) trehalose ABC transporter substrate-binding lipoprotein LpqY
  KO
K02027  multiple sugar transport system substrate-binding protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Module
mtu_M00207  Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv1235 (lpqY)
Transporters [BR:mtu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    Rv1235 (lpqY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_1 SBP_bac_8
Motif
Other DBs
NCBI-GeneID: 887145
NCBI-ProteinID: NP_215751
TubercuList: Rv1235
UniProt: P9WGU9
Position
1377524..1378930
Genome map
AA seq 468 aa AA seqDB search
MVMSRGRIPRLGAAVLVALTTAAAACGADSQGLVVSFYTPATDGATFTAIAQRCNQQFGG
RFTIAQVSLPRSPNEQRLQLARRLTGNDRTLDVMALDVVWTAEFAEAGWALPLSDDPAGL
AENDAVADTLPGPLATAGWNHKLYAAPVTTNTQLLWYRPDLVNSPPTDWNAMIAEAARLH
AAGEPSWIAVQANQGEGLVVWFNTLLVSAGGSVLSEDGRHVTLTDTPAHRAATVSALQIL
KSVATTPGADPSITRTEEGSARLAFEQGKAALEVNWPFVFASMLENAVKGGVPFLPLNRI
PQLAGSINDIGTFTPSDEQFRIAYDASQQVFGFAPYPAVAPGQPAKVTIGGLNLAVAKTT
RHRAEAFEAVRCLRDQHNQRYVSLEGGLPAVRASLYSDPQFQAKYPMHAIIRQQLTDAAV
RPATPVYQALSIRLAAVLSPITEIDPESTADELAAQAQKAIDGMGLLP
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtggtcatgagtcgcgggcggataccgaggctgggcgctgccgtactggtggcgttgacg
accgcggcggcggcgtgcggggccgatagccaggggctggtggtcagcttctacacaccg
gccaccgacggcgcgacgttcaccgcaattgcccaacgctgcaaccaacagttcggcggc
cggttcaccattgcgcaggtcagcttgcccaggtcccccaatgagcaacggttacagctg
gcccgacggttgaccggtaacgaccgcaccctggacgtcatggcgctggatgtggtgtgg
acggcggagttcgccgaagcggggtgggcgctgccgctgtcggacgacccagcggggctg
gccgagaacgacgccgtcgccgataccctgccaggcccgcttgcgacggccggctggaac
cacaagctgtacgcggcacccgtcaccactaatactcaattgctttggtaccgaccagat
ttggtaaatagcccgccaacggattggaatgccatgatcgctgaggcggcccggctgcac
gcggcgggcgagcctagctggatcgcggtacaggccaatcagggcgagggcttagtggtg
tggttcaacacgctgctggtgagcgctggtggatcggtgctctccgaggacggccggcac
gtcaccttgaccgatactcccgcacaccgagcggctacggtcagcgcgctacagatcctc
aaatcggtggctaccacgcccggcgccgacccctcgatcacccgcaccgaagagggcagc
gcgcggttggccttcgaacagggcaaggccgcgctcgaggtcaattggccgttcgtgttt
gcgtccatgctcgagaacgcggtgaagggtggtgtgcccttcttaccgcttaaccggatt
ccgcagttggccggcagcatcaacgacatcgggacgttcacgcccagcgacgagcagttc
cgcatcgcgtatgacgccagccagcaggtgttcggtttcgcgccctatccggctgtagcg
cccggccagccagccaaggtgacgatcggcgggttgaacctggcggtggccaagacgacc
cgccatcgagcggaggcattcgaagcggtgcgttgtctgcgtgaccagcacaatcagagg
tacgtctcgctcgaggggggtctgcccgcggtgcgggcgtcgctgtactccgatccgcaa
ttccaggcgaagtatccgatgcacgccattattcggcagcaactcaccgatgccgcggtg
cggccggcgacgccggtgtaccaggcgttgtccatccggctcgcggcggtgctgagcccg
atcaccgagatcgacccggagtccacggccgacgaacttgccgcgcaggcgcagaaagcc
atcgacggcatgggcctgctcccgtga

DBGET integrated database retrieval system