KEGG   Mycobacterium tuberculosis H37Rv: Rv1239cHelp
Entry
Rv1239c           CDS       T00015                                 

Gene name
corA
Definition
(RefSeq) magnesium and cobalt transport transmembrane protein CorA
  KO
K03284  magnesium transporter
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv1239c (corA)
Transporters [BR:mtu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rv1239c (corA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CorA Phasin
Motif
Other DBs
NCBI-GeneID: 887106
NCBI-ProteinID: NP_215755
TubercuList: Rv1239c
UniProt: A0A089QNT2 O50455
Position
complement(1381942..1383042)
Genome map
AA seq 366 aa AA seqDB search
MFPGFDALPEVLRPVARPQPPNAHPVAQPPAQALVDCGVYVCGQRLPGKYTYAAALREVR
EIELTGQEAFVWIGLHEPDENQMQDVADVFGLHPLAVEDAVHAHQRPKLERYDETLFLVL
KTVNYVPHESVVLAREIVKTGEIMIFVGKDFVVTVRHGEHGGLSEVRKRMDADPEHLRLG
PYAVMHAIADYVVDHYLEVTNLMETDIDSIEEVAFAPGRKLDIEPIYLLKREVVELRRCV
NPLSTAFQRMQTESKDLISKEVRRYLRDVADHQTEAADQIASYDDMLNSLVQAALARVGM
QQNMDMRKISAWAGIIAVPTMIAGIYGMNFHFMPELDSRWGYPTVIGGMVLICLFLYHVF
RNRNWL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgttcccagggtttgacgcattgcccgaagtgctgcgaccggtcgcgcgaccccagccg
ccgaacgcacaccccgttgcccagccaccggcccaagccttggtcgactgcggtgtctac
gtctgcggccagcgactgcccggcaagtacacctacgccgccgcgctgcgcgaggtgcgc
gagatcgaactgaccgggcaggaggcgttcgtctggatcgggctgcacgagcccgatgaa
aaccagatgcaggacgtagcagacgttttcgggttgcacccgttagccgttgaggacgcc
gtgcacgcgcaccagcgacccaagttggagcgctacgacgagacgctgttcctcgtcctc
aagaccgtcaactacgtcccgcacgaatcggtggtactggcccgcgagatcgtcaaaacc
ggcgagatcatgatcttcgtcggcaaggatttcgtggtcaccgtccgccacggcgaacac
ggcgggttatccgaggtgcgtaagcggatggatgccgaccccgaacatttgcggttggga
ccgtatgcggtgatgcacgcgatcgccgactacgtggtcgaccactacctcgaggtgacc
aatctcatggagaccgatatcgacagcatcgaggaagtagcgttcgcgccgggccgcaag
ctcgacatcgaaccgatctatctgctcaagcgggaagtggtcgagttgcgccggtgcgtg
aatccgctatcgaccgcattccagcgcatgcagaccgagagcaaagacctcatttcgaaa
gaagtgcggcgctacctgcgcgacgtcgccgaccaccagaccgaggccgccgaccagatc
gccagctacgacgacatgctcaactcgctggtgcaggccgcgctcgcccgggtcggcatg
cagcaaaacatggacatgcgcaagatatccgcgtgggcaggtatcatcgcggtccccacc
atgatcgcgggcatctatggcatgaactttcacttcatgcccgagctggactccaggtgg
ggttacccgacagtgatcggcgggatggtccttatctgtctgttcctctaccacgtcttc
cgcaacagaaactggctctag

DBGET integrated database retrieval system