KEGG   Mycobacterium tuberculosis H37Rv: Rv1242Help
Entry
Rv1242            CDS       T00015                                 

Gene name
vapC33
Definition
(RefSeq) ribonuclease VapC33
  KO
K07064  uncharacterized protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Rv1242 (vapC33)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN
Motif
Other DBs
NCBI-GeneID: 887095
NCBI-ProteinID: NP_215758
TubercuList: Rv1242
UniProt: P9WF69 I6X0R7
Position
1384535..1384966
Genome map
AA seq 143 aa AA seqDB search
MIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAP
LPTADAIAYVREWLSQPNVDLLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDA
EIHSSDTDFARFADLKWTDPLRE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatccctgacatcaatctgctgctctacgcggtcatcaccggattcccgcagcac
cggcgcgcgcatgcgtggtggcaagacaccgtcaacggccacacccgtatcgggctgacg
tatccggcgttgttcgggttcctacggatcgccaccagtgcccgcgtgctcgccgcgcca
ctgccaaccgcggatgcgatcgcctatgtgcgcgagtggctttcgcagccgaacgtggac
ctactcacggcgggtccgcgccacctggacatcgcgttgggcctgctcgacaagctcggc
acagccagccacctaaccaccgatgtgcaactggccgcctacggcatcgaatacgacgcc
gagatccattccagtgacaccgactttgcccgattcgccgatctgaagtggaccgacccg
ttgcgcgaataa

DBGET integrated database retrieval system