KEGG   Mycobacterium tuberculosis H37Rv: Rv1249cHelp
Entry
Rv1249c           CDS       T00015                                 

Definition
(RefSeq) membrane protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EcsC HTH_32 TetR_C_30 UCR_Fe-S_N
Motif
Other DBs
NCBI-GeneID: 887077
NCBI-ProteinID: NP_215765
TubercuList: Rv1249c
UniProt: O50464 A0A089S4L6
Position
complement(1393194..1393982)
Genome map
AA seq 262 aa AA seqDB search
MSARRIRSWKRFDNRSANAAEPDPQLAGTGGRPKVSTRALAQVIERSSRIQGPAAQAYVA
RLRRAHPGASPAKIVAKLEKRFLSVVTASGAAVGAAATLPGIGTLAAWFAAAGEVVVFLE
ATALFVLALASVHAIPLDHRERRRALVLAVLVGDNTTAVADLLGPGRTSGGWVSETMASL
PLPAISSLNSRMLKYVVKRFALKRGALMFGKLVPMGIGAIIGAIGNRLVGKKLVRNARSA
FGTPPARWPVTLHVLPTVRDAS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcgacgaatcaggtcttggaaaaggttcgacaatcgatccgcaaatgcagct
gagccggacccgcagctggccgggaccggcgggcggcccaaagtgtccacgcgggcattg
gcgcaggtcatcgaacggagttcgcggatacagggcccggcagcacaggcgtatgtggcc
cgcctgcgtcgcgcccacccgggggccagccccgccaagatcgtagccaagctcgagaaa
cgcttcttgtcggtggtgacggccagtggagcggcggtaggtgcggccgcgaccttaccg
gggatcggcaccctggccgcatggttcgccgcggccggagaggttgtcgtgttccttgag
gccaccgcgctgttcgtgctggcgctggcctcggtacacgccattcccctcgaccaccga
gaacggcgccgtgccctggtcttggcggtgctggtcggcgacaacactactgcggtggcc
gatctgctcggtccgggccgaaccagcggcggctgggtgtcggagaccatggcctcgctg
ccgctgccggcgatatcgtcgttgaactcgcgaatgctcaaatacgtcgtcaaacgattc
gcgctgaaacgcggcgcgctcatgtttggcaagctggtgccgatgggtatcggcgcgatc
atcggcgccatcggcaatcggctggtcggcaagaagctcgtccgtaatgcgcgatcggca
ttcggcaccccgccggcgcgctggccggtcaccctgcacgtgctaccgaccgttcgggat
gccagctag

DBGET integrated database retrieval system