KEGG   Mycobacterium tuberculosis H37Rv: Rv1252cHelp
Entry
Rv1252c           CDS       T00015                                 

Gene name
lprE
Definition
(RefSeq) lipoprotein LprE
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_21
Motif
Other DBs
NCBI-GeneID: 887064
NCBI-ProteinID: NP_215768
TubercuList: Rv1252c
UniProt: P9WK49 I6X0S6
Position
complement(1399296..1399904)
Genome map
AA seq 202 aa AA seqDB search
MPGVWSPPCPTTPRVGVVAALVAATLTGCGSGDSTVAKTPEATPSLSTAHPAPPSSEPSP
PSATAAPPSNHSAAPVDPCAVNLASPTIAKVVSELPRDPRSEQPWNPEPLAGNYNECAQL
SAVVIKANTNAGNPTTRAVMFHLGKYIPQGVPDTYGFTGIDTSQCTGDTVALTYASGIGL
NNVVKFRWNGGGVELIGNTTGG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggtgtgtggtcaccaccctgccccaccacgccgcgtgttggcgtggtcgctgca
ttggtcgccgcgacgttgaccggttgcggttcgggcgactccacggtcgctaagacgccg
gaggccaccccatccctgtcaactgctcacccggccccgccgagcagcgaaccgagcccg
ccgtccgcgacagctgccccacccagcaaccacagcgccgcgccggtcgacccgtgtgcg
gtgaacctcgcctcgcccacaatcgccaaagtcgtctccgaacttcctcgcgatccgcgc
agtgagcagccctggaacccagaaccgctggccggcaactacaacgagtgtgcccagctg
tcggcggtggtcatcaaggccaacacgaacgccggcaatccgaccacccgcgcggtgatg
ttccacctcggcaagtacataccgcagggggtgcccgatacctatgggttcaccggcatc
gacacctcgcagtgcacgggagacacggtggcattgacgtatgccagcggcatcgggttg
aacaacgttgtcaagttccgctggaacggcggcggcgtcgagctgatcggcaacaccacc
ggcggttaa

DBGET integrated database retrieval system