KEGG   Mycobacterium tuberculosis H37Rv: Rv1258c
Entry
Rv1258c           CDS       T00015                                 
Name
(RefSeq) multidrug-efflux transporter
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB
Motif
Pfam: MFS_1 MFS_3 Sugar_tr CAAD
Other DBs
NCBI-GeneID: 887056
NCBI-ProteinID: NP_215774
TubercuList: Rv1258c
UniProt: P9WJX9
Position
complement(1406081..1407340)
AA seq 419 aa
MRNSNRGPAFLILFATLMAAAGDGVSIVAFPWLVLQREGSAGQASIVASATMLPLLFATL
VAGTAVDYFGRRRVSMVADALSGAAVAGVPLVAWGYGGDAVNVLVLAVLAALAAAFGPAG
MTARDSMLPEAAARAGWSLDRINGAYEAILNLAFIVGPAIGGLMIATVGGITTMWITATA
FGLSILAIAALQLEGAGKPHHTSRPQGLVSGIAEGLRFVWNLRVLRTLGMIDLTVTALYL
PMESVLFPKYFTDHQQPVQLGWALMAIAGGGLVGALGYAVLAIRVPRRVTMSTAVLTLGL
ASMVIAFLPPLPVIMVLCAVVGLVYGPIQPIYNYVIQTRAAQHLRGRVVGVMTSLAYAAG
PLGLLLAGPLTDAAGLHATFLALALPIVCTGLVAIRLPALRELDLAPQADIDRPVGSAQ
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagaaacagcaaccgcggcccggcattcctgatcctgttcgcaacgctgatggcggcc
gcgggtgatggcgtctcgatagtcgcgtttccgtggctggtgttgcagcgcgagggcagc
gctgggcaggcctcgatcgtggccagtgcgaccatgctgccgctgttgttcgccacgctg
gtcgccggcaccgcggtcgactacttcgggcgtcgccgggtgtcgatggtggccgatgcg
ctgtcgggtgcggcggtggccggcgtccccctggtggcgtgggggtacggcggcgacgcg
gtcaacgtgctggtgctggccgtattggccgccctggcggccgccttcggcccggcaggc
atgacggctcgtgactcgatgctgcccgaggccgccgctcgggcaggctggtcgttggac
cgcatcaacggcgcctacgaggcgatcctcaacctggcctttattgtcggcccggccatc
ggtggcttgatgatcgcgacggttggcggcatcaccacaatgtggattaccgcgacggca
ttcgggttgtccatcctcgcgattgccgccctgcaactcgagggtgccggcaagccgcac
cacacctcgcggccccaagggttggtatccgggatcgccgaggggctgcgcttcgtctgg
aacctgcgggtattgcgcaccctcgggatgattgacctgaccgtcaccgcgctgtatctg
ccgatggagagcgtgctgttcccgaaatacttcaccgaccaccagcaaccggtgcagctg
ggttgggcgttgatggcgatcgccggcggcggcctggtgggagcgctggggtatgccgtg
ttggctatccgcgttccccgtcgcgtgaccatgtcgaccgcggttcttaccctgggtttg
gcatcgatggtcatcgcgttcctgccgccactgccggtcatcatggtgttgtgcgcggtg
gtcggcctggtgtacggacccatccagccgatctataactacgtgatacagacgcgggca
gcacagcatctgcgcggccgggtagtcggggtgatgacgtcgctggcctacgccgccggc
ccgttgggtctgttgctggccggtccactgaccgacgccgctggactgcatgccacgttt
ctcgcgttggcactgcccatcgtgtgcaccgggctggtcgcgatccggctgcccgcgctg
cgcgaactggatctggcgccccaagcggacatcgatcggcccgtaggatcggctcagtga

DBGET integrated database retrieval system