KEGG   Mycobacterium tuberculosis H37Rv: Rv1262cHelp
Entry
Rv1262c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HIT DcpS_C CwfJ_C_1
Motif
Other DBs
NCBI-GeneID: 887036
NCBI-ProteinID: NP_215778
TubercuList: Rv1262c
UniProt: P9WML1 I6X0T4
Position
complement(1409938..1410372)
Genome map
AA seq 144 aa AA seqDB search
MPCVFCAIIAGEAPAIRIYEDGGYLAILDIRPFTRGHTLVLPKRHTVDLTDTPPEALADM
VAIGQRIARAARATKLADATHIAINDGRAAFQTVFHVHLHVLPPRNGDKLSVAKGMMLRR
DPDREATGRILREALAQQDAAAQD
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgccctgcgtgttctgtgcgatcatcgccggggaggctccggccatccggatctacgag
gacggcggctatctcgcgatcctcgacatccgcccgttcacccgcggccacacgctggtg
ctgcccaagcgacacaccgttgacctcaccgacaccccgccggaggcgttggctgacatg
gtcgccatcggccaacgcatcgcgcgggcggcccgcgccacgaagttggctgacgcgaca
cacatcgccatcaacgacggccgtgccgcttttcagacggtgttccacgttcacttgcac
gtattaccgccgcgcaacggcgacaagctgtcggtcgccaagggaatgatgctgcgccgc
gacccggaccgggaagccaccggacggatcctgcgggaggcgctggcgcaacaggatgcc
gctgcgcaagactga

DBGET integrated database retrieval system