KEGG   Mycobacterium tuberculosis H37Rv: Rv1264Help
Entry
Rv1264            CDS       T00015                                 

Definition
(RefSeq) adenylyl cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv1264
Enzymes [BR:mtu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Rv1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ad_Cy_reg Guanylate_cyc FeoA
Motif
Other DBs
NCBI-GeneID: 887035
NCBI-ProteinID: NP_215780
TubercuList: Rv1264
UniProt: P9WMU9 I6XXK8
Structure
PDB: 

Position
1411894..1413087
Genome map
AA seq 397 aa AA seqDB search
MTDHVREADDANIDDLLGDLGGTARAERAKLVEWLLEQGITPDEIRATNPPLLLATRHLV
GDDGTYVSAREISENYGVDLELLQRVQRAVGLARVDDPDAVVHMRADGEAAARAQRFVEL
GLNPDQVVLVVRVLAEGLSHAAEAMRYTALEAIMRPGATELDIAKGSQALVSQIVPLLGP
MIQDMLFMQLRHMMETEAVNAGERAAGKPLPGARQVTVAFADLVGFTQLGEVVSAEELGH
LAGRLAGLARDLTAPPVWFIKTIGDAVMLVCPDPAPLLDTVLKLVEVVDTDNNFPRLRAG
VASGMAVSRAGDWFGSPVNVASRVTGVARPGAVLVADSVREALGDAPEADGFQWSFAGPR
RLRGIRGDVRLFRVRRGATRTGSGGAAQDDDLAGSSP
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaccacgtgcgcgaggcggacgacgcgaacatcgacgatctgttgggcgacctg
ggcggtaccgcgcgcgccgagcgtgcgaagcttgtcgagtggttgctcgagcagggcatc
acccccgacgagattcgggcgaccaacccgccgttgctgctggccacccgccacctcgtc
ggcgacgacggcacctacgtatccgcaagggagattagcgagaactatggcgttgacctc
gagctgctgcagcgggtgcagcgcgctgtcggtctggccagagtggatgatcctgacgcg
gtggtgcacatgcgtgccgacggtgaggcggccgcacgcgcacagcggttcgttgagctg
gggctgaatcccgaccaagtcgtgctggtcgtgcgtgtgctcgccgagggcttgtcacac
gccgccgaggccatgcgctacaccgcgctggaggccattatgcggccgggggctaccgag
ttggacatcgcgaaggggtcgcaggcgctggtgagccagatcgtgccgctgctggggccg
atgatccaggacatgctgttcatgcagctgcggcacatgatggagacggaggccgtcaac
gccggagagcgtgcggccggcaagccgctaccgggagcgcgacaggtcaccgttgccttc
gccgacctggtcggtttcacccagctaggcgaagtggtgtcggccgaagagctagggcac
ctcgccgggcggctggccggcctcgcgcgtgacctgaccgctccgccggtgtggttcatt
aagacgatcggcgacgcggtcatgttggtctgtcctgatccggcgccattgctggacacc
gtgctgaagctggtcgaggtcgtcgacaccgacaacaactttccccggctgcgagccggc
gtcgcctccgggatggcggttagccgggccggcgactggttcggcagcccggtcaacgtg
gcaagccgggtgaccggggtggcgcgcccgggtgccgtgctggtcgcggattcggtgcgg
gaggcccttggtgatgcccccgaagccgacggatttcagtggtccttcgccggcccccgt
cgcctcaggggaatccggggtgacgtcaggctttttcgagtccggcgaggggccactcgc
accggctccggcggcgcggcccaagacgacgatttggccggctcgtcaccgtag

DBGET integrated database retrieval system