KEGG   Mycobacterium tuberculosis H37Rv: Rv1265Help
Entry
Rv1265            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 887058
NCBI-ProteinID: NP_215781
TubercuList: Rv1265
UniProt: P9WM49
Position
1413260..1413940
Genome map
AA seq 226 aa AA seqDB search
MVLARPDAVFAPARNRCHVSLPVNAMSLKMKVCNHVIMRHHHMHGRRYGRPGGWQQAQQP
DASGAAEWFAGRLPEDWFDGDPTVIVDREEITVIGKLPGLESPEEESAARASGRVSRFRD
ETRPERMTIADEAQNRYGRKVSWGVEVGGERILFTHIAVPVMTRLKQPERQVLDTLVDAG
VARSRSDALAWSVKLVGEHTEEWLAKLRTAMSAVDDLRAQGPDLPA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggttctcgccaggccggacgctgttttcgcgccggccaggaaccggtgtcacgtttcg
ctgccggtgaacgcgatgtcattaaagatgaaagtatgtaatcatgtaattatgaggcac
catcacatgcacgggcggcgctacggtcgccccggcggctggcagcaagctcagcaacca
gatgccagtggggcggcggaatggttcgctggccgcctgcccgaggactggttcgacggc
gaccccaccgtcatcgtcgaccgtgaagaaattacggtgattggcaagctgcctggactc
gagagccccgaggaagaaagtgcggcccgagcctcgggccgcgtgtcgcgattccgcgac
gaaacccgaccggagcgaatgactatcgccgatgaagcccagaatcgctacggacgcaag
gtgtcctggggcgtcgaggtcggtggtgagcgaatcttgttcacgcacatcgcagtaccg
gtgatgacgcggttaaagcagccggaacggcaggtgctggacaccttggtcgacgctggc
gtggctcgttcccgctcggatgccctcgcgtggtcggtcaagctggtcggcgagcacacc
gaggagtggctggccaagctgcgcaccgccatgtcggcggtggacgatctgcgcgcgcaa
ggcccggatcttccggcctaa

DBGET integrated database retrieval system