KEGG   Mycobacterium tuberculosis H37Rv: Rv1269cHelp
Entry
Rv1269c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4189
Motif
Other DBs
NCBI-GeneID: 887039
NCBI-ProteinID: NP_215785
TubercuList: Rv1269c
UniProt: P9WM45 I6XXL1
Position
complement(1418579..1418953)
Genome map
AA seq 124 aa AA seqDB search
MTTMITLRRRFAVAVAGVATAAATTVTLAPAPANAADVYGAIAYSGNGSWGRSWDYPTRA
AAEATAVKSCGYSDCKVLTSFTACGAVAANDRAYQGGVGPTLAAAMKDALTKLGGGYIDT
WACN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatgattactcttcggcgacggttcgcggtggccgtcgccggcgtcgccact
gccgccgcgacgaccgtcaccctggctcccgcaccagcaaatgccgccgatgtctatggc
gcaattgcctactccggcaacggctcgtggggccgatcgtgggactacccaacccgggcg
gctgccgaagccaccgccgtcaagtcgtgtggctactccgactgcaaggtgctcaccagt
ttcaccgcctgcggcgccgtcgccgccaacgatagggcataccagggaggagttggaccc
accttggccgccgccatgaaggacgccctgaccaagctcggcggcggctacatcgacacc
tgggcctgcaactaa

DBGET integrated database retrieval system