KEGG   Mycobacterium tuberculosis H37Rv: Rv1270cHelp
Entry
Rv1270c           CDS       T00015                                 

Gene name
lprA
Definition
(RefSeq) lipoprotein LprA
  KO
K14955  lipoprotein LprA
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    Rv1270c (lprA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LppX_LprAFG
Motif
Other DBs
NCBI-GeneID: 887017
NCBI-ProteinID: NP_215786
TubercuList: Rv1270c
UniProt: P9WK55 I6XB42
Position
complement(1419014..1419748)
Genome map
AA seq 244 aa AA seqDB search
MKHPPCSVVAAATAILAVVLAIGGCSTEGDAGKASDTAATASNGDAAMLLKQATDAMRKV
TGMHVRLAVTGDVPNLRVTKLEGDISNTPQTVATGSATLLVGNKSEDAKFVYVDGHLYSD
LGQPGTYTDFGNGASIYNVSVLLDPNKGLANLLANLKDASVAGSQQADGVATTKITGNSS
ADDIATLAGSRLTSEDVKTVPTTVWIASDGSSHLVQIQIAPTKDTSVTLTMSDWGKQVTA
TKPV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatccaccttgttccgttgttgccgccgccaccgccatactcgccgtcgtcctg
gcgatcggcggctgctcaaccgaaggggacgccggcaaagcgtctgacaccgcggccacg
gcatccaacggcgatgcggccatgctactcaagcaggccaccgatgcgatgcgcaaggtc
accggaatgcacgtcagacttgcggtgacaggcgacgtgccaaacctgcgggtgaccaag
ctcgaaggcgatatctccaacacaccgcagacggttgccaccggtagcgcgacattgctc
gtcggcaacaagagcgaagacgcgaagttcgtctatgttgacggtcacctgtactccgac
ctaggccagcccggcacctacaccgatttcggcaacggcgcctcgatctacaacgtgtcg
gtgctcctcgaccccaacaagggcctggccaacctgttggctaacctcaaggacgcgtcg
gttgccggcagccagcaggcggacggtgtcgcgaccaccaagatcaccgggaactcgtct
gctgacgacatcgcgacgctggccggctcacgtctgacctccgaagacgtcaaaacggtg
cccaccaccgtctggatcgcttcggatggatcctcgcacttggtccagatccagatcgct
cccaccaaagacacgtcggtgacgttgacgatgtccgactggggtaagcaggtcaccgcc
accaaaccggtctag

DBGET integrated database retrieval system