KEGG   Mycobacterium tuberculosis H37Rv: Rv1272cHelp
Entry
Rv1272c           CDS       T00015                                 

Definition
(RefSeq) drug ABC transporter ATP-binding protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran ABC_membrane_2 SMC_N AAA_16 AAA_30 AAA_22 RsgA_GTPase AAA_23 AAA AAA_28 MMR_HSR1 DUF87 AAA_29 FtsK_SpoIIIE cobW AAA_18 TsaE AAA_33 AAA_7
Motif
Other DBs
NCBI-GeneID: 887021
NCBI-ProteinID: NP_215788
TubercuList: Rv1272c
UniProt: P9WQJ3 I6X0U1
Position
complement(1420410..1422305)
Genome map
AA seq 631 aa AA seqDB search
MTAPPGARPRAASPPPNMRSRDFWGSAARLVKRLAPQRRLSIAVITLGIAGTTIGVIVPR
ILGHATDLLFNGVIGRGLPGGITKAQAVASARARGDNTFADLLSGMNVVPGQGVDFAAVE
RTLALALALYLAAALMIWAQARLLNLTVQKTMVRLRTDVEDKVHRLPLSYFDGQQRGELL
SRVTNDIDNLQSSLSMTISQLVTSILTMVAVLAMMVSISGLLALITLLTVPLSLLVTRAI
TRRSQPLFVAHWTSTGRLNAHLEETYSGFTVVKTFGHQAAARERFHELNDDVYQAGFGAQ
FLSGLVQPATAFIGNLGYVAVAVAGGLQVATGQITLGSIQAFIQYIRQFNMPLSQLAGMY
NALQSGVASAERVFDVLDEPEESPEPEPELPNLTGRVEFEHVNFAYLPGTPVIRDLSLVA
EPGSTVAIVGPTGAGKTTLVNLLMRFYEIGSGRILIDGVDIASVSRQSLRSRIGMVLQDT
WLYDGTIAENIAYGRPEATTDEIVEAARAAHVDRFVNTLPAGYQTRVSGDGGSISVGEKQ
LITIARAFLARPQLLILDEATSSVDTRTELLIQRAMRELRRDRTSFIIAHRLSTIRDADH
ILVVQTGQIVERGNHAELLARRGVYYQMTRA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgccaccgggcgcacgcccccgtgccgcaagcccgcccccgaacatgcggtcc
cgcgacttctggggatcggcagcccgactggtgaaacggctggcgccacaacgccggctg
agcatcgcggtgatcacactgggaatcgccggcacgacgatcggcgtcatcgttccacgg
atcctcggccatgccaccgatttgctgttcaacggcgtgatcgggcgagggctaccgggg
ggaatcaccaaggcacaggccgtcgcttcggctcgggcccgtggtgacaacaccttcgcc
gacctgctgtccgggatgaacgtggtgccgggccaaggtgtggacttcgccgcggtggag
cgaacactggcgctggcgttggcgctgtatctggctgcagcgctgatgatttgggcacaa
gcccggctgctcaacctcaccgtgcagaaaacgatggtcaggttgcggaccgatgtcgaa
gacaaggtgcaccggctgccgctgtcctacttcgacggacaacagcgcggtgagctgctg
agccgggtcaccaatgacatcgacaacctccagtcgtcgctgtcaatgacgatcagccag
ctggtgacgtcgattctgaccatggtggcggtgctggccatgatggtgtcgatctcgggc
ctgctggcgctgatcacactgctgacggtgccgctgtcgctgctggtgacacgcgcgatc
acccggcggtcacagcccctattcgtagctcactggaccagcaccgggcgcctcaacgcc
catctcgaagagacctacagcgggttcacggtagtcaagacgttcggccaccaagcggcc
gcacgagaacggttccacgagttgaatgacgacgtctaccaggccggtttcggcgcccag
ttcctctctggtctcgtgcagccggcgacggcgttcatcggcaacctcggctacgtcgcg
gtcgcggtggccggtggcctgcaggtagccaccgggcagatcacgctcggcagcatccag
gcgttcatccagtacatccgccagttcaacatgccgctgagccagctggccgggatgtac
aacgccctgcagtccggggtggccagcgcggagcgggtgttcgacgtgctcgacgagccc
gaggagtcgccggagcctgagccggagctgccgaacctaaccggacgggtcgagtttgag
cacgtgaactttgcttacctcccgggcacgccggtgatccgcgacctgtcgctggtggcc
gaaccgggtagcacggtggcgatcgtcggaccgacgggagccggcaagaccacgctggtg
aacctgctaatgcggttctacgagatcggttccggacgaatcctgatcgacggggtggat
atcgcctcggtaagccggcagtcgctgcgatcgcgaatcggcatggtgttgcaagacacc
tggctctacgacgggaccatcgcggagaacatcgcctacggacggccggaggccaccaca
gacgagatagtagaagccgccagggcggcccatgtcgaccggtttgtgaacacactgcct
gctggctaccagacacgggtcagcggcgacggcggcagcatcagcgtcggcgagaagcaa
ctcattaccatcgcccgcgcctttcttgcccgcccgcagctgttgatcctggacgaggcg
accagctcggtcgatacccgcaccgagctgctcatccagcgagcgatgcgcgagcttcgc
cgggatcgtacgagtttcattatcgcccaccgactttcgacgattcgcgatgccgaccac
atcctggtggtccagaccggccagatcgtcgaacgcggcaaccacgccgagctgttggcc
cggcgcggggtctattaccagatgacgcgggcctag

DBGET integrated database retrieval system