KEGG   Mycobacterium tuberculosis H37Rv: Rv1279Help
Entry
Rv1279            CDS       T00015                                 

Definition
(RefSeq) GMC-type oxidoreductase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO Pyr_redox_2 FAD_binding_2 Lycopene_cycl NAD_binding_8 Thi4
Motif
Other DBs
NCBI-GeneID: 887002
NCBI-ProteinID: NP_215795
TubercuList: Rv1279
UniProt: P9WMV5 I6XXL8
Position
1430062..1431648
Genome map
AA seq 528 aa AA seqDB search
MDTQSDYVVVGTGSAGAVVASRLSTDPATTVVALEAGPRDKNRFIGVPAAFSKLFRSEID
WDYLTEPQPELDGREIYWPRGKVLGGSSSMNAMMWVRGFASDYDEWAARAGPRWSYADVL
GYFRRIENVTAAWHFVSGDDSGVTGPLHISRQRSPRSVTAAWLAAARECGFAAARPNSPR
PEGFCETVVTQRRGARFSTADAYLKPAMRRKNLRVLTGATATRVVIDGDRAVGVEYQSDG
QTRIVYARREVVLCAGAVNSPQLLMLSGIGDRDHLAEHDIDTVYHAPEVGCNLLDHLVTV
LGFDVEKDSLFAAEKPGQLISYLLRRRGMLTSNVGEAYGFVRSRPELKLPDLELIFAPAP
FYDEALVPPAGHGVVFGPILVAPQSRGQITLRSADPHAKPVIEPRYLSDLGGVDRAAMMA
GLRICARIAQARPLRDLLGSIARPRNSTELDEATLELALATCSHTLYHPMGTCRMGSDEA
SVVDPQLRVRGVDGLRVADASVMPSTVRGHTHAPSVLIGEKAADLIRS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggacactcagagcgactacgtcgtggtcggtaccggctcagccggggcggttgtggcc
agccggcttagcaccgatccggccacgacggtggtggccctggaggcggggccgcgtgac
aagaacagattcatcggcgtcccagcggcgttttccaagctgttccgcagcgagatcgac
tgggattacctaaccgaaccgcagccggagctcgacggccgcgaaatctattggcctcgt
ggcaaggtgctcggtggctcgtcgtccatgaacgcaatgatgtgggtgcgtggattcgca
tcagactacgatgagtgggccgcgcgagccggtccgcggtggtcgtacgccgacgtgctc
ggctactttcgccgcatcgagaacgtcaccgctgcctggcactttgtcagcggtgacgac
agcggagtaaccggtccgttgcatatttcccggcaacgcagcccaagatcggtgaccgca
gcgtggctggcagccgcacgtgagtgcggatttgccgctgcgcggccgaattcccctcga
ccggaaggcttttgcgagaccgtcgtcacccagcgccgcggtgctcgattcagtactgcc
gacgcctatctgaagcccgcgatgcgccgtaaaaacctccgtgtgcttaccggcgccact
gctacccgggtggtcatcgacggcgaccgggccgtcggcgtggaataccaaagcgacggt
caaacccgcatcgtctacgcccgccgcgaggtggtgctctgcgctggtgccgtcaacagc
cctcagctgctgatgctctccggcatcggcgaccgcgaccacctcgccgaacacgacatc
gacaccgtttaccacgcgcccgaggtcgggtgcaacctgctcgatcatctcgtcacggtg
ctgggtttcgacgtcgaaaaggacagcttgtttgccgccgagaagcccggccagttgatc
agctacttactgcgacgccgcggcatgctcacctccaacgtcggcgaggcgtacggattt
gtccgcagccgacccgaactgaagctgcccgatttggagttgatttttgccccggcgccg
ttttacgacgaagcgctggttccaccggctggtcacggtgtggtattcggcccgattctg
gtcgcgccgcaaagccgtggccagatcacgctgcggtccgccgatccgcatgccaagcct
gtcatcgaaccgcgttacctgtccgatctcggtggcgtagaccgggccgccatgatggcg
ggcctgcggatatgcgcgcggatcgcgcaggcccgcccgctcagagatctccttgggtcc
atcgcgcgaccgcgcaacagcaccgagctggacgaggccactctcgagttggcgctggcc
acttgttcgcacaccctgtaccacccgatgggcacctgccgcatgggcagcgacgaggcc
agcgtggtggatccgcagctgcgggtccgcggtgtcgacggactccgcgtcgccgacgcg
tcggtgatgcccagcacggttcgtgggcatacgcatgcgccgtcggtgctgatcggggag
aaggccgccgacttaatccgcagctga

DBGET integrated database retrieval system