KEGG   Mycobacterium tuberculosis H37Rv: Rv1284Help
Entry
Rv1284            CDS       T00015                                 

Gene name
canA
Definition
(RefSeq) beta-carbonic anhydrase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00910  Nitrogen metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Rv1284 (canA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     Rv1284 (canA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-GeneID: 886987
NCBI-ProteinID: NP_215800
TubercuList: Rv1284
UniProt: P9WPJ7
Structure
PDB: 

Position
1437324..1437815
Genome map
AA seq 163 aa AA seqDB search
MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAG
CVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESY
PDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgacggttaccgacgactacctggccaacaacgtggactacgcgagcggtttcaagggc
ccgctaccgatgccgccgagcaaacacatcgcaatcgtggcgtgcatggacgcccggctg
gacgtctaccgcatgctgggcatcaaggagggcgaggcacacgtcatccgcaacgccgga
tgcgtggtcaccgacgatgtgatccgttcactggccatcagccagcggctgctgggaacc
cgcgaaatcatcctgctgcaccacaccgactgtgggatgctgactttcaccgacgacgac
ttcaagcgcgccatccaggacgagaccggcatcagacccacgtggtcgcccgagtcgtac
cccgacgccgtcgaggacgtccgtcagtcgctgcgccgcatcgaggtcaacccgttcgtc
accaagcacacgtcgctgcgcggcttcgtcttcgatgtcgccaccggcaaactcaacgag
gtcacgccctag

DBGET integrated database retrieval system