KEGG   Mycobacterium tuberculosis H37Rv: Rv1287Help
Entry
Rv1287            CDS       T00015                                 

Definition
(RefSeq) HTH-type transcriptional regulator
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrf2 TFIIE_alpha HrcA_DNA-bdg
Motif
Other DBs
NCBI-GeneID: 886998
NCBI-ProteinID: NP_215803
TubercuList: Rv1287
UniProt: P9WME3 I6X0V2
Position
1440805..1441290
Genome map
AA seq 161 aa AA seqDB search
MRMSAKAEYAVRAMVQLATAASGTVVKTDDLAAAQGIPPQFLVDILTNLRTDRLVRSHRG
REGGYELARPGTEISIADVLRCIDGPLASVRDIGLGDLPYSGPTTALTDVWRALRASMRS
VLEETTLADVAGGALPEHVAQLADDYRAQESTRHGASRHGD
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcggatgtcagctaaggcggagtacgcggtgcgggcgatggtccagctcgccacggcc
gccagtggcaccgtggtcaagaccgacgatctggctgcggcccaaggcataccaccgcag
tttctcgtcgatatcctgaccaacctgcgcaccgaccgcctggtgcgaagccaccgcggt
cgcgagggtggttatgaattggcgcgtccgggcaccgagatcagcatcgccgacgtattg
cgctgcatcgacggaccgctggctagtgtccgcgatatcggacttggcgacctgccctac
tcgggccccactaccgcgctgaccgacgtttggcgcgcgctgcgcgccagtatgcggtcg
gtgctggaggagaccacgctggctgacgttgccggtggcgcgctgcccgagcacgtcgcc
cagctcgccgacgactatcgcgcgcaggagagcacgcggcacggcgcctcgcgccatggt
gactag

DBGET integrated database retrieval system