KEGG   Mycobacterium tuberculosis H37Rv: Rv1290AHelp
Entry
Rv1290A           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 3205114
NCBI-ProteinID: YP_177642
TubercuList: Rv1290A
UniProt: Q79FQ6 A0A089QNX5
Position
1445058..1445372
Genome map
AA seq 104 aa AA seqDB search
MLALHGLSEGVSGSGGSGGRWGAGEVLEGARIGVIADGVSCFPTKADCRRIRGVPVFDGY
TRMVARLMGSLAVLRSVSIPKGYRDFGFGSLRAVAPKNCPDVSG
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
gtgttggcgctgcatgggttatcagaaggggtttcggggtcggggggatcgggtggccga
tggggtgcaggggaagttctggaaggcgctcgaatcggggttatcgccgacggtgtgtcc
tgctttcctaccaaggccgactgcaggcggatccgtggcgtgccggtgttcgacggctat
acgcggatggtcgcccggctgatgggatcgctcgccgtgttgcggtcggtgagcattcca
aagggctaccgggacttcggctttggcagtctacgtgcggtggcgccgaaaaactgcccg
gacgtgagtggctga

DBGET integrated database retrieval system