KEGG   Mycobacterium tuberculosis H37Rv: Rv1297Help
Entry
Rv1297            CDS       T00015                                 

Gene name
rho
Definition
(RefSeq) transcription termination factor Rho
  KO
K03628  transcription termination factor Rho
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Rv1297 (rho)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mtu03021]
    Rv1297 (rho)
   03019 Messenger RNA biogenesis [BR:mtu03019]
    Rv1297 (rho)
Transcription machinery [BR:mtu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription termination factor
     Rv1297 (rho)
Messenger RNA biogenesis [BR:mtu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Rv1297 (rho)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rho_RNA_bind ATP-synt_ab Rho_N AAA_25 NACHT AAA HNF-1_N
Motif
Other DBs
NCBI-GeneID: 886952
NCBI-ProteinID: NP_215813
TubercuList: Rv1297
UniProt: P9WHF3 I6XXN3
Position
1453204..1455012
Genome map
AA seq 602 aa AA seqDB search
MTDTDLITAGESTDGKPSDAAATDPPDLNADEPAGSLATMVLPELRALANRAGVKGTSGM
RKNELIAAIEEIRRQANGAPAVDRSAQEHDKGDRPPSSEAPATQGEQTPTEQIDSQSQQV
RPERRSATREAGPSGSGERAGTAADDTDNRQGGQQDAKTEERGTDAGGDQGGDQQASGGQ
QARGDEDGEARQGRRGRRFRDRRRRGERSGDGAEAELREDDVVQPVAGILDVLDNYAFVR
TSGYLPGPHDVYVSMNMVRKNGMRRGDAVTGAVRVPKEGEQPNQRQKFNPLVRLDSINGG
SVEDAKKRPEFGKLTPLYPNQRLRLETSTERLTTRVIDLIMPIGKGQRALIVSPPKAGKT
TILQDIANAITRNNPECHLMVVLVDERPEEVTDMQRSVKGEVIASTFDRPPSDHTSVAEL
AIERAKRLVEQGKDVVVLLDSITRLGRAYNNASPASGRILSGGVDSTALYPPKRFLGAAR
NIEEGGSLTIIATAMVETGSTGDTVIFEEFKGTGNAELKLDRKIAERRVFPAVDVNPSGT
RKDELLLSPDEFAIVHKLRRVLSGLDSHQAIDLLMSQLRKTKNNYEFLVQVSKTTPGSMD
SD
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatacggacctcattacggctggcgaaagtaccgacggcaagccgtcggatgcc
gctgccacagatcccccagacctcaacgccgacgagccggccggctcgctggccaccatg
gtgctgcccgaactgcgtgcgctggctaatcgagccggcgtgaagggaacatcgggtatg
cggaagaacgaactgatcgctgcgattgaggagatcaggcgacaggccaacggcgcccca
gccgttgaccggtcggctcaagagcacgacaagggcgaccggccgcccagttccgaggca
ccggccacccagggggaacagaccccgaccgaacagatcgattcccaaagccaacaggtc
cgcccggagcggcgcagcgccacccgtgaagcgggaccctccggctccggtgagcgtgcg
ggcacagccgcagacgacaccgacaaccgccaaggcggtcaacaggacgccaagaccgag
gagcgtggcaccgacgcgggtggcgaccaagggggtgaccagcaggcttcgggcggtcag
caggcgcgcggcgacgaggacggagaagcgcgtcagggccggcgcggacgccggttccgc
gatcggcggcgccgcggtgaacgatccggcgacggcgccgaggctgaactgcgtgaggac
gacgtcgtccagccggtagccggcatactcgacgtcctggacaactacgcgtttgtgcgc
acctccggctacctacccggtccgcacgacgtgtatgtgtcgatgaacatggtgcgcaag
aacggcatgcgccgtggtgatgcggtgaccggtgcggtgcgggtgcccaaggaaggggag
caacccaaccagcggcagaagttcaacccgctggtccgcctggacagcatcaacggcgga
tcggtcgaagacgccaagaagcggcccgagttcggcaaactgacgccgttgtaccccaac
cagcggcttcgtctggaaaccagtaccgagcggctgaccacccgggtcatcgacctcatc
atgccgatcggcaagggtcaacgcgcgttgattgtgtcgccgcccaaagcgggcaagaca
acgatcctgcaggacatcgccaacgcgatcaccaggaacaacccggaatgccacctcatg
gtcgtgctcgtcgacgagcggcctgaggaggtcaccgatatgcagcgctcggtcaaaggc
gaggtcatcgcttcaactttcgaccggccgccgtcggaccacacgtcggtcgccgagctg
gcgatcgaacgcgccaagcggctggtggagcaaggcaaggacgtcgtggtgctgctcgat
tcaatcacccggctaggccgcgcttacaacaacgcgtcgccggcgtcgggccggatcctg
tccggtggtgtcgattccacggcgttgtacccgcccaagcgcttcctgggggccgcgcgc
aacatcgaagagggcgggtcgctgaccatcatcgccactgcgatggtcgagaccgggtcc
actggtgacacggtcattttcgaggagttcaagggcaccggcaacgccgagctcaagctg
gaccgcaagatcgccgagcggcgggttttccctgcggtcgacgtgaacccttctggaacc
cgcaaggacgagctactgctgtcgcccgacgagttcgctattgtgcacaagctgcgccgc
gtgctatcgggcctggattcccaccaggccatcgacctgctgatgtcgcagctgcgtaag
acgaagaacaactacgaattccttgttcaggtgtccaagaccacgccagggtccatggac
agcgactga

DBGET integrated database retrieval system