KEGG   Mycobacterium tuberculosis H37Rv: Rv1298Help
Entry
Rv1298            CDS       T00015                                 

Gene name
rpmE
Definition
(RefSeq) 50S ribosomal protein L31
  KO
K02909  large subunit ribosomal protein L31
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu03010  Ribosome
Module
mtu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Rv1298 (rpmE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mtu03011]
    Rv1298 (rpmE)
Ribosome [BR:mtu03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    Rv1298 (rpmE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L31 DUF1364
Motif
Other DBs
NCBI-GeneID: 886955
NCBI-ProteinID: NP_215814
TubercuList: Rv1298
UniProt: P9WHA1 I6XB64
Structure
PDB: 

Position
1455163..1455405
Genome map
AA seq 80 aa AA seqDB search
MKSDIHPAYEETTVVCGCGNTFQTRSTKPGGRIVVEVCSQCHPFYTGKQKILDSGGRVAR
FEKRYGKRKVGADKAVSTGK
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgacattcatccggcatatgaggagaccaccgtggtctgcggatgcggcaat
accttccagacgcgtagcaccaagccgggaggtcgtattgtggttgaggtttgttcgcag
tgtcatccgttctacaccggcaagcagaagatcctcgacagcggcggccgggtggctcgc
ttcgagaagcggtacggcaagcgcaaggtcggagctgacaaggcggtttcaaccggcaaa
tag

DBGET integrated database retrieval system