KEGG   Mycobacterium tuberculosis H37Rv: Rv1299Help
Entry
Rv1299            CDS       T00015                                 

Gene name
prfA
Definition
(RefSeq) peptide chain release factor PrfA
  KO
K02835  peptide chain release factor 1
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mtu03012]
    Rv1299 (prfA)
Translation factors [BR:mtu03012]
 Eukaryotic Type
  Release factors
   Rv1299 (prfA)
 Prokaryotic Type
   Rv1299 (prfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCRF RF-1 ABC_tran_CTD CHASE3
Motif
Other DBs
NCBI-GeneID: 886948
NCBI-ProteinID: NP_215815
TubercuList: Rv1299
UniProt: P9WHG3 I6YA68
Position
1455495..1456568
Genome map
AA seq 357 aa AA seqDB search
MTQPVQTIDVLLAEHAELELALADPALHSNPAEARRVGRRFARLAPIVATHRKLTSARDD
LETARELVASDESFAAEVAALEARVGELDAQLTDMLAPRDPHDADDIVLEVKSGEGGEES
ALFAADLARMYIRYAERHGWAVTVLDETTSDLGGYKDATLAIASKADTPDGVWSRMKFEG
GVHRVQRVPVTESQGRVHTSAAGVLVYPEPEEVGQVQIDESDLRIDVFRSSGKGGQGVNT
TDSAVRITHLPTGIVVTCQNERSQLQNKTRALQVLAARLQAMAEEQALADASADRASQIR
TVDRSERIRTYNFPENRITDHRIGYKSHNLDQVLDGDLDALFDALSAADKQSRLRQS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagccagtgcagacgattgacgtgttgctcgccgaacacgccgagctcgagctt
gcgctggcagatcccgcgctgcacagcaatccggccgaggcgcgcagagtcgggcgccgg
tttgcccgattggccccgatcgtcgcaacccaccgcaagctgacgtccgcgcgcgacgac
ctcgagaccgcgcgcgagctggtggcttccgacgagtcgttcgccgccgaggttgccgca
ttggaggctcgggtgggcgaactggatgcccaactcactgacatgttggcaccgcgtgac
ccgcacgatgccgatgacattgtgctggaagtcaaatccggcgaggggggcgaagaatcc
gcgttgttcgccgccgatttggccaggatgtatatccgctacgccgagcggcacggctgg
gcggtgacggtgttggacgagaccacctcggatctgggtgggtacaaggacgcgacgttg
gcgattgccagcaaagccgacacccccgacggggtgtggtcgcgcatgaagttcgagggc
ggggtgcaccgcgtacaacgggtcccagtgacggaatcccaaggccgcgtgcatacttcg
gcggcgggtgtgctggtctatccggagcccgaggaagtcggccaagtgcagatcgacgag
tcggatctgcgtatcgacgttttccggtcgtccggcaagggcgggcagggagtgaatacc
accgactccgcggtgcgtatcacccatctgcccactggaatcgtcgtcacctgtcagaac
gaacggtcgcagctgcagaacaagacgcgtgcgttgcaggtgctggccgctcggttgcag
gcaatggccgaggagcaggcgctggccgacgcgtcggccgaccgggctagccaaatccgc
actgtggaccgtagtgaacgcattcgcacctacaacttcccggagaaccggatcaccgac
caccggatcggttacaagtcacacaatctcgatcaggtgctggatggcgatcttgacgcg
ttgttcgacgctctgtccgccgcggacaagcaatcccggttgcgacaatcatga

DBGET integrated database retrieval system