KEGG   Mycobacterium tuberculosis H37Rv: Rv1302Help
Entry
Rv1302            CDS       T00015                                 

Gene name
rfe
Definition
(RefSeq) decaprenyl-phosphate N-acetylglucosaminephosphotransferase
  KO
K02851  UDP-GlcNAc:undecaprenyl-phosphate/decaprenyl-phosphate GlcNAc-1-phosphate transferase [EC:2.7.8.33 2.7.8.35]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00572  Arabinogalactan biosynthesis - Mycobacterium
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00572 Arabinogalactan biosynthesis - Mycobacterium
    Rv1302 (rfe)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtu01003]
    Rv1302 (rfe)
   01005 Lipopolysaccharide biosynthesis proteins [BR:mtu01005]
    Rv1302 (rfe)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.33  UDP-N-acetylglucosamine---undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
     Rv1302 (rfe)
    2.7.8.35  UDP-N-acetylglucosamine---decaprenyl-phosphate N-acetylglucosaminephosphotransferase
     Rv1302 (rfe)
Glycosyltransferases [BR:mtu01003]
 Polysaccharide
  Bacterial polysaccharide
   Rv1302 (rfe)
Lipopolysaccharide biosynthesis proteins [BR:mtu01005]
 O-antigen
  Rv1302 (rfe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-GeneID: 886947
NCBI-ProteinID: NP_215818
TubercuList: Rv1302
UniProt: P9WMW5
Position
1458295..1459509
Genome map
AA seq 404 aa AA seqDB search
MQYGLEVSSDVAGVAGGLLALSYRGAGVPLRELALVGLTAAIITYFATGPVRMLASRLGA
VAYPRERDVHVTPTPRMGGLAMFLGIVGAVFLASQLPALTRGFVYSTGMPAVLVAGAVIM
GIGLIDDRWGLDALTKFAGQITAASVLVTMGVAWSVLYIPVGGVGTIVLDQASSILLTLA
LTVSIVNAMNFVDGLDGLAAGLGLITALAICMFSVGLLRDHGGDVLYYPPAVISVVLAGA
CLGFLPHNFHRAKIFMGDSGSMLIGLMLAAASTTAAGPISQNAYGARDVFALLSPFLLVV
AVMFVPMLDLLLAIVRRTRAGRSAFSPDKMHLHHRLLQIGHSHRRVVLIIYLWVGIVAFG
AASSIFFNPRDTAAVMLGAIVVAGVATLIPLLRRGDDYYDPDLD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtacggtctcgaggtgtccagcgatgtggccggcgttgccggtggcttgctcgcc
ctgtcctatcgcggcgccggtgtcccgctgcgtgagcttgcgctggtcgggctgaccgcg
gcgatcatcacctattttgcgaccggtccggtgcggatgctggccagtcgcctgggagcc
gtcgcctacccgcgggagcgagatgtgcacgtcacgcctacccctcggatgggtgggttg
gcgatgttcctgggcattgtcggcgccgtctttcttgcctcccagcttccggcactcacc
cgggggttcgtctattccaccggcatgcccgcggtgctggtggccggtgcggtgatcatg
ggcatcggcctgatcgatgatcgttggggtctggatgcactgacgaagttcgccggccag
atcacggcggcgagcgttctggtcaccatgggtgtcgcctggagtgtcctgtacatcccg
gtgggtggtgtgggcaccatcgtcttggaccaggcttcctcgatcctgcttaccctggcg
ctgaccgtttcgatcgtcaacgcgatgaactttgtcgacggtctcgacgggctggccgcc
ggcctgggcctgataacggcgctggcaatctgcatgttctcggtgggtttgcttcgtgac
cacggtggtgacgttttgtactacccgccggcggtgatttcggtggtcctggccggggcc
tgcctgggctttctgccacacaacttccaccgggccaagatcttcatgggcgattccggg
tcgatgctgatcggcctgatgctggccgccgcttccaccaccgcggccgggccgatctcg
cagaacgcctacggcgctcgtgatgtatttgctttgctgtcgccgttcctgctggtggtg
gcggtcatgtttgtgccaatgctcgacctgctgctagcgatcgtccgtcgcacccgcgcc
ggccgcagcgcgtttagcccggacaaaatgcacctgcatcaccggctgctgcagatcggt
cattcccatcggcgcgtggtcctgatcatctacctgtgggtgggcatcgttgccttcggc
gccgcgagctcgatcttctttaacccgcgcgacaccgcggcggtgatgctgggcgcgatc
gtggtcgccggcgtcgcgacactgatccccctgttgcgccgcggcgacgactactacgac
ccggacctggactag

DBGET integrated database retrieval system