KEGG   Mycobacterium tuberculosis H37Rv: Rv1303Help
Entry
Rv1303            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_I
Motif
Other DBs
NCBI-GeneID: 886944
NCBI-ProteinID: NP_215819
TubercuList: Rv1303
UniProt: P9WM31 I6XB69
Position
1459766..1460251
Genome map
AA seq 161 aa AA seqDB search
MTTPAQDAPLVFPSVAFRPVRLFFINVGLAAVAMLVAGVFGHLTVGMFLGLGLLLGLLNA
LLVRRSAESITAKEHPLKRSMALNSASRLAIITILGLIIAYIFRPAGLGVVFGLAFFQVL
LVATTALPVLKKLRTATEEPVATYSSNGQTGGSEGRSASDD
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacaccagcgcaggacgcgccgttggtgtttccctctgttgctttccgtccggtt
cgcctttttttcatcaacgttggactggccgcagtggcgatgttggtcgccggcgtgttc
ggtcacctgacggtcgggatgttcttgggtctcgggttgctgctgggtttgctcaatgcc
ctgctggtgcggcgttcggccgagtcgatcaccgccaaagagcacccgttaaaacggtcg
atggccctcaactcggcatcgcgactggcgattatcaccatcctcgggctgatcatcgcc
tacattttccggcccgctggattgggcgtcgtgttcgggctggcattcttccaggtgctg
ctggtggcaacgacggccctgccggtcctgaagaagctgcgcactgcgaccgaggaaccg
gtcgcaacttattcttccaatggccagaccgggggatcggaaggaaggagcgccagcgat
gactga

DBGET integrated database retrieval system