KEGG   Mycobacterium tuberculosis H37Rv: Rv1309Help
Entry
Rv1309            CDS       T00015                                 

Gene name
atpG
Definition
(RefSeq) ATP synthase subunit gamma
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00190  Oxidative phosphorylation
mtu01100  Metabolic pathways
Module
mtu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rv1309 (atpG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:mtu00194]
    Rv1309 (atpG)
Photosynthesis proteins [BR:mtu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Rv1309 (atpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt IF-2B Flagellin_N
Motif
Other DBs
NCBI-GeneID: 886929
NCBI-ProteinID: NP_215825
TubercuList: Rv1309
UniProt: P9WPU9 I6YA77
Position
1464884..1465801
Genome map
AA seq 305 aa AA seqDB search
MAATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYAFEITRMLTTLAAE
AALDHPLLVERPEPKRAGVLVVSSDRGLCGAYNANIFRRSEELFSLLREAGKQPVLYVVG
RKAQNYYSFRNWNITESWMGFSEQPTYENAAEIASTLVDAFLLGTDNGEDQRSDSGEGVD
ELHIVYTEFKSMLSQSAEAHRIAPMVVEYVEEDIGPRTLYSFEPDATMLFESLLPRYLTT
RVYAALLESAASELASRQRAMKSATDNADDLIKALTLMANRERQAQITQEISEIVGGANA
LAEAR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggctgccacacttcgcgaactacgcgggcggatccgctcggcagggtcgatcaaaaag
atcaccaaggcccaggagctgattgcgacatcgcgcatcgccagggcgcaggctcggctc
gagtccgctcggccctacgcttttgagatcacccggatgcttaccaccctggccgctgaa
gccgcactggaccatccgttgctcgtcgagcgcccggagccgaaacgagccggcgtgctg
gtggtgtcgtccgatcgtggtttgtgcggcgcatacaacgccaatattttccgtcgctcc
gaggagctgttctccctgctgagggaggccggaaagcagccggtgctgtatgtggtgggc
cgtaaggcgcagaactactacagttttcggaactggaacatcaccgagtcgtggatgggt
ttctccgagcaacccacgtacgagaacgccgccgagatcgcttcgaccttagtggatgcg
ttcctgctcggcaccgacaacggcgaggatcaacggtccgacagcggcgagggcgtcgac
gaactgcacatcgtttacaccgagttcaagtcgatgctgtcgcaatcggcggaggctcac
cggatcgcccccatggtggtggagtacgtcgaggaagacatcggaccgcgcacgctgtac
tcgttcgagcccgacgcgacgatgctgttcgagtcattgttgccgcgctacctgactacc
cgggtgtacgcggcgctgctggagtccgcggcgtcggagcttgcctcgcggcaacgtgcg
atgaagtcggccaccgacaacgccgatgacctcatcaaggccctgacgctgatggcaaac
cgcgagcggcaggcccagatcacccaggagattagtgaaatcgtcggtggcgcaaatgcg
ctcgccgaagcccgctag

DBGET integrated database retrieval system