KEGG   Mycobacterium tuberculosis H37Rv: Rv1311Help
Entry
Rv1311            CDS       T00015                                 

Gene name
atpC
Definition
(RefSeq) ATP synthase subunit epsilon
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00190  Oxidative phosphorylation
mtu01100  Metabolic pathways
Module
mtu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rv1311 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:mtu00194]
    Rv1311 (atpC)
Photosynthesis proteins [BR:mtu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Rv1311 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N
Motif
Other DBs
NCBI-GeneID: 886967
NCBI-ProteinID: NP_215827
TubercuList: Rv1311
UniProt: P9WPV1 I6Y678
Structure
PDB: 

Position
1467315..1467680
Genome map
AA seq 121 aa AA seqDB search
MAELNVEIVAVDRNIWSGTAKFLFTRTTVGEIGILPRHIPLVAQLVDDAMVRVEREGEKD
LRIAVDGGFLSVTEEGVSILAESAEFESEIDEAAAKQDSESDDPRIAARGRARLRAVGAI
D
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattgaacgttgagatcgtcgccgtcgaccggaacatctggtcgggtacggcg
aagtttctgttcacccgcaccaccgtcggtgagatcggcatcctgccccgccacattccg
ttggtggcccaattggtcgatgacgccatggtgcgggtcgagcgggagggagaaaaggac
ctgaggatcgcggtcgacggcgggttcctgtcggtgaccgaggagggcgtcagcattctc
gccgaatctgccgagttcgagtcggagatcgacgaggccgccgccaagcaggattccgaa
tccgacgatccccgcatcgctgccaggggccgcgccagattgcgcgccgtcggcgcgatc
gactaa

DBGET integrated database retrieval system