KEGG   Mycobacterium tuberculosis H37Rv: Rv1321Help
Entry
Rv1321            CDS       T00015                                 

Definition
(RefSeq) endonuclease NucS
  KO
K07503  endonuclease [EC:3.1.-.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rv1321
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Rv1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NucS UPF0102
Motif
Other DBs
NCBI-GeneID: 886908
NCBI-ProteinID: NP_215837
TubercuList: Rv1321
UniProt: P9WIY5
Position
1484279..1484959
Genome map
AA seq 226 aa AA seqDB search
MSRVRLVIAQCTVDYIGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWMSPPCWLT
EESGGQAPVWVVENKAGEQLRITIEGIEHDSSHELGVDPGLVKDGVEAHLQALLAEHIQL
LGEGYTLVRREYMTAIGPVDLLCSDERGGSVAVEIKRRGEIDGVEQLTRYLELLNRDSVL
APVKGVFAAQQIKPQARILATDRGIRCLTLDYDTMRGMDSGEYRLF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgggtgcgtctagtcatcgcccagtgcactgtcgactacatcggccggctcacc
gcgcatctgccgtccgcgcgccggctgttgctgttcaaggccgacggatcggtcagcgta
catgctgacgaccgcgcctacaagccgttgaactggatgagtccgccgtgctggttgacc
gaagagtccggcggccaggcgccagtgtgggtggtcgagaacaaggccggcgagcagctg
cgcatcactatcgaaggaatcgagcacgacagtagccacgagctgggcgtggaccccggg
ctggtcaaggacggcgtcgaggcccacttgcaggcgttgctcgccgagcacatccaattg
ctgggcgaagggtacacgctggtccgccgcgagtacatgaccgcgatcggacccgtcgac
ctgctgtgcagcgacgaacgaggtggctcggtcgcggtggaaatcaagcggcgtggcgag
atcgacggcgtggagcagctgacccgctacctcgagttgctcaaccgcgacagtgtgctc
gcgccggtcaagggggtgtttgccgctcaacagatcaagccgcaggctcggattctggcc
accgaccgcgggatccgttgtttgacattggattacgacacaatgcgcgggatggatagc
ggcgagtaccggctgttctga

DBGET integrated database retrieval system