KEGG   Mycobacterium tuberculosis H37Rv: Rv1327cHelp
Entry
Rv1327c           CDS       T00015                                 

Gene name
glgE
Definition
(RefSeq) alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase
  KO
K16147  starch synthase (maltosyl-transferring) [EC:2.4.99.16]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00500  Starch and sucrose metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rv1327c (glgE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.16  starch synthase (maltosyl-transferring)
     Rv1327c (glgE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3416 Alpha-amylase GHL6
Motif
Other DBs
NCBI-GeneID: 886895
NCBI-ProteinID: NP_215843
TubercuList: Rv1327c
UniProt: P9WQ17
Structure
PDB: 

Position
complement(1492320..1494425)
Genome map
AA seq 701 aa AA seqDB search
MSGRAIGTETEWWVPGRVEIDDVAPVVSCGVYPAKAVVGEVVPVSAAVWREGHEAVAATL
VVRYLGVRYPHLTDRPRARVLPTPSEPQQRVKPLLIPMTSGQEPFVFHGQFTPDRVGLWT
FRVDGWGDPIHTWRHGLIAKLDAGQGETELSNDLLVGAVLLERAATGVPRGLRDPLLAAA
AALRTPGDPVTRTALALTPEIEELLADYPLRDLVTRGEQFGVWVDRPLARFGAWYEMFPR
STGGWDDDGNPVHGTFATAAAELPRIAGMGFDVVYLPPIHPIGKVHRKGRNNSPTAAPTD
VGSPWAIGSDEGGHDTVHPSLGTIDDFDDFVSAARDLGMEVALDLALQCAPDHPWAREHR
QWFTELPDGTIAYAENPPKKYQDIYPLNFDNDPEGLYDEVLRVVQHWVNHGVKFFRVDNP
HTKPPNFWAWLIAQVKTVDPDVLFLSEAFTPPARQYGLAKLGFTQSYSYFTWRTTKWELT
EFGNQIAELADYRRPNLFVNTPDILHAVLQHNGPGMFAIRAVLAATMSPAWGMYCGYELF
EHRAVREGSEEYLDSEKYELRPRDFASALDQGRSLQPFITRLNIIRRLHPAFQQLRTIHF
HHVDNDALLAYSKFDPATGDCVLVVVTLNAFGPEEATLWLDMAALGMEDYDRFWVRDEIT
GEEYQWGQANYIRIDPARAVAHIINMPAVPYESRNTLLRRR
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggccgggcaatcggaacggaaacggagtggtgggtgcccggtcgtgtcgaaatc
gatgacgtcgcgcccgtcgtttcgtgcggcgtatatcccgccaaggcggtggtcggcgag
gtggtcccggtcagcgcggcggtctggcgtgaaggccacgaggccgtcgcagcgacgctg
gtcgtgcgctacctcggagtgcgttacccacacctcaccgacagaccccgggccagggtg
cttccgacgccgagcgagccccaacaacgcgtcaagccgctgctgatcccgatgacgagc
ggccaggagcccttcgttttccacggccagttcacccccgaccgggtcggattgtggacc
ttccgggtggatggttggggtgacccgatccacacctggcgccatgggctgatagccaag
ctagatgccggccagggagagaccgagctgtccaacgacctgttggtaggcgcggtgctg
ttggagcgcgcggcgaccggtgtgccgcgcgggttacgcgatcccctcctggcggccgcg
gcagcgctgcggacccccggtgacccggtgacccgcaccgcgttggccctgacaccggaa
atcgaagagctgctggccgactatccgctgcgggacctggtcacccggggcgagcaattc
ggcgtctgggtggatcggccgttggcccggttcggcgcttggtatgagatgtttccgcgc
tcaaccggcgggtgggacgacgacggcaacccggtacacggcaccttcgccaccgctgcg
gcagaacttccgcgcatcgccggcatggggttcgacgtggtgtacctgccgccgatccat
ccaattggcaaggtgcatcgcaagggtcgcaacaactcgcccaccgccgcaccgacagac
gtgggatcgccgtgggcgatcggtagcgatgagggcggtcacgataccgttcatcccagc
ctgggcaccatcgacgacttcgacgacttcgtctccgcggcacgcgatctgggcatggag
gtcgcgctggacctggcgctgcaatgcgcaccggatcatccgtgggcccgcgaacaccgg
cagtggttcaccgagctgccggacggcaccatcgcctacgcggagaatccaccgaagaag
taccaggacatctatccgctcaacttcgacaacgatcccgagggcctgtacgacgaagtg
ctgcgcgtggtgcaacattgggttaaccacggcgtcaagttctttcgcgtcgacaatccc
cacaccaaaccacccaacttctgggcctggctgatcgcgcaggtgaagaccgtcgacccc
gacgtgctgttcctgtccgaggctttcaccccgcccgcccgccagtacgggctggccaag
ctcggcttcacgcagtcctacagctatttcacctggcgcacgaccaagtgggagctcacc
gaattcggcaaccagatagccgaactcgccgactaccgtcggcccaacctgttcgtcaac
accccggacatcctgcacgcggtgctgcagcacaacggtccaggcatgttcgccatccgc
gcggtgctggccgccaccatgagcccagcctgggggatgtactgcggttatgagcttttc
gagcaccgtgcggtgcgcgagggcagcgaggagtacctggactcggagaagtacgaattg
cgtccccgcgactttgccagcgcgctggaccagggtagatctttgcagccgttcatcaca
cggctcaatataattcgccggctgcacccggcgtttcaacagttgcgtaccattcatttt
caccacgttgacaacgacgcgttgctggcctacagcaagttcgacccggccaccggcgac
tgcgtgttggtggtggtgacactcaacgcatttggtcctgaagaagctacgctgtggttg
gacatggcggcgttgggcatggaggactacgaccggttttgggtgcgcgacgagataacc
ggcgaagaataccaatgggggcaagccaattacatccgcatcgacccagcacgggcagtc
gcccacatcatcaacatgccagccgtgccctacgagagccgaaacacgctgctgcgcagg
aggtga

DBGET integrated database retrieval system