KEGG   Mycobacterium tuberculosis H37Rv: Rv1410cHelp
Entry
Rv1410c           CDS       T00015                                 

Gene name
P55
Definition
(RefSeq) aminoglycosides/tetracycline-transport integral membrane protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr TRI12 FtsX
Motif
Other DBs
NCBI-GeneID: 886709
NCBI-ProteinID: NP_215926
TubercuList: Rv1410c
UniProt: P9WJY3
Position
complement(1586210..1587766)
Genome map
AA seq 518 aa AA seqDB search
MRAGRRVAISAGSLAVLLGALDTYVVVTIMRDIMNSVGIPINQLHRITWIVTMYLLGYIA
AMPLLGRASDRFGRKLMLQVSLAGFIIGSVVTALAGHFGDFHMLIAGRTIQGVASGALLP
ITLALGADLWSQRNRAGVLGGIGAAQELGSVLGPLYGIFIVWLLHDWRDVFWINVPLTAI
AMVMIHFSLPSHDRSTEPERVDLVGGLLLALALGLAVIGLYNPNPDGKHVLPDYGAPLLV
GALVAAVAFFGWERFARTRLIDPAGVHFRPFLSALGASVAAGAALMVTLVDVELFGQGVL
QMDQAQAAGMLLWFLIALPIGAVTGGWIATRAGDRAVAFAGLLIAAYGYWLISHWPVDLL
ADRHNILGLFTVPAMHTDLVVAGLGLGLVIGPLSSATLRVVPSAQHGIASAAVVVARMTG
MLIGVAALSAWGLYRFNQILAGLSAAIPPNASLLERAAAIGARYQQAFALMYGEIFTITA
IVCVFGAVLGLLISGRKEHADEPEVQEQPTLAPQVEPL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcaggacgtcgagtcgcgattagcgcgggcagcctggcagtactgctgggcgcc
ctggacacctatgtcgtggtcaccatcatgcgcgacatcatgaacagcgttggtataccg
atcaaccaactccaccggatcacctggatcgtcacgatgtacctcctgggctacatcgcc
gccatgccgttgctgggccgggcttccgaccgattcgggcgcaagctgatgctgcaggtc
agcctggccgggttcatcatcggctcggtagtgaccgcgctggccgggcattttggcgat
ttccacatgctgatcgcgggccgcacgatccagggtgttgccagcggcgcgctattgccg
atcacgctggcgctgggcgccgatttgtggtcgcagcgcaaccgcgccggcgtgctcggc
ggtatcggcgccgcgcaggagctcggcagcgttctgggcccgttgtacggaatcttcatc
gtttggctattgcacgactggcgtgacgtgttctggatcaacgtcccgttgaccgcgatc
gccatggtaatgatccacttcagcctgccctcacacgaccgcagcacggagcccgagcga
gtcgacctggtcggtggtctgctgctggcactcgcgttgggcctcgccgtcatcgggctg
tacaaccccaatcccgacggcaaacacgtactgccggactacggggctccgttgctggtc
ggcgctctcgttgccgcggtggcgttcttcggttgggaacgtttcgctcgcacccggctg
atcgacccggccggtgtgcacttccggccgttcctgtccgcgctgggtgcctccgtcgcc
gccggcgcggcgctgatggtgacgctggttgatgtcgagctgttcggccagggcgtgctg
cagatggaccaggctcaggcggccggaatgctgctgtggttccttatcgccctaccgatc
ggggcagtgacgggcgggtggatcgccaccagggccggtgaccgtgcggtggcctttgcc
ggactgcttattgcggcgtacggttactggcttatttcccactggccggtggacctgttg
gccgatcggcacaacatcctcggattgttcaccgtgccggcgatgcacaccgacctggtg
gtggctggtttagggttggggctggtgatcgggccgctatcgtcggccaccctacgggtt
gtcccgtcggcccagcacggcatcgcttcggcggcggtggtggtcgcccggatgaccggc
atgttgatcggcgtggccgcgctgagcgcctgggggttgtaccggttcaaccagatcctg
gcggggttgtcggcggccatcccgcccaacgccagcctgctcgagcgcgcggccgcaatt
ggagcccggtaccagcaggcgttcgcgctgatgtacggcgagatattcaccatcaccgcg
atcgtgtgcgtgttcggcgcggtgctaggtctgttgatcagcggccgcaaggaacatgcc
gatgaaccggaagtccaggagcaaccgaccctggcgccccaagtggagccgctctaa

DBGET integrated database retrieval system