KEGG   Mycobacterium tuberculosis H37Rv: Rv1484Help
Entry
Rv1484            CDS       T00015                                 

Gene name
inhA
Definition
(RefSeq) NADH-dependent enoyl-[ACP] reductase
  KO
K11611  meromycolic acid enoyl-[acyl-carrier-protein] reductase [EC:1.3.1.118]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv1484 (inhA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.118  meromycolic acid enoyl-[acyl-carrier-protein] reductase
     Rv1484 (inhA)
Lipid biosynthesis proteins [BR:mtu01004]
 Fatty acid synthase
  Component type
   Rv1484 (inhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-GeneID: 886523
NCBI-ProteinID: NP_216000
TubercuList: Rv1484
UniProt: P9WGR1
Structure
PDB: 

Position
1674202..1675011
Genome map
AA seq 269 aa AA seqDB search
MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaggactgctggacggcaaacggattctggttagcggaatcatcaccgactcgtcg
atcgcgtttcacatcgcacgggtagcccaggagcagggcgcccagctggtgctcaccggg
ttcgaccggctgcggctgattcagcgcatcaccgaccggctgccggcaaaggccccgctg
ctcgaactcgacgtgcaaaacgaggagcacctggccagcttggccggccgggtgaccgag
gcgatcggggcgggcaacaagctcgacggggtggtgcattcgattgggttcatgccgcag
accgggatgggcatcaacccgttcttcgacgcgccctacgcggatgtgtccaagggcatc
cacatctcggcgtattcgtatgcttcgatggccaaggcgctgctgccgatcatgaacccc
ggaggttccatcgtcggcatggacttcgacccgagccgggcgatgccggcctacaactgg
atgacggtcgccaagagcgcgttggagtcggtcaacaggttcgtggcgcgcgaggccggc
aagtacggtgtgcgttcgaatctcgttgccgcaggccctatccggacgctggcgatgagt
gcgatcgtcggcggtgcgctcggcgaggaggccggcgcccagatccagctgctcgaggag
ggctgggatcagcgcgctccgatcggctggaacatgaaggatgcgacgccggtcgccaag
acggtgtgcgcgctgctgtctgactggctgccggcgaccacgggtgacatcatctacgcc
gacggcggcgcgcacacccaattgctctag

DBGET integrated database retrieval system