KEGG   Mycobacterium tuberculosis H37Rv: Rv1634
Entry
Rv1634            CDS       T00015                                 

Name
(RefSeq) multidrug-efflux transporter
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB
Motif
Pfam: MFS_1 PCLP
Other DBs
NCBI-GeneID: 885115
NCBI-ProteinID: NP_216150
TubercuList: Rv1634
UniProt: P9WJX3
Position
1839168..1840583
AA seq 471 aa
MTETASETGSWRELLSRYLGTSIVLAGGVALYATNEFLTISLLPSTIADIGGSRLYAWVT
TLYLVGSVVAATTVNTMLLRVGARSSYLMGLAVFGLASLVCAAAPSMQILVAGRTLQGIA
GGLLAGLGYALINSTLPKSLWTRGSALVSAMWGVATLIGPATGGLFAQLGLWRWAFGVMT
LLTALMAMLVPVALGAGGVGPGGETPVGSTHKVPVWSLLLMGAAALAISVAALPNYLVQT
AGLLAAAALLVAVFVVVDWRIHAAVLPPSVFGSGPLKWIYLTMSVQMIAAMVDTYVPLFG
QRLGHLTPVAAGFLGAALAVGWTVGEVASASLNSARVIGHVVAAAPLVMASGLALGAVTQ
RADAPVGIIALWALALLIIGTGIGIAWPHLTVRAMDSVADPAESSAAAAAINVVQLISGA
FGAGLAGVVVNTAKGGEVAAARGLYMAFTVLAAAGVIASYQATHRDRRLPR
NT seq 1416 nt   +upstreamnt  +downstreamnt
gtgaccgaaacagcgagcgagaccggcagctggcgtgagctactgagcaggtatctgggc
acctccatagtgctggccggtggcgtcgcgctttacgccaccaacgagtttctgacaatc
agcctgctgccgagcacaatcgccgacatcgggggtagccggctgtacgcctgggtgaca
accctgtatctggtcgggtcggtggtggcggcgaccaccgtcaatacgatgttgctgcgc
gtcggggcgcgctcgtcgtatctgatggggttggccgtcttcggtctggccagcctggta
tgtgcggcggcgccgagcatgcagattctggtggccgggcgtaccttgcaaggaatagcc
ggtgggctgctggccggcctaggctacgcgctgatcaactcgaccttgcccaagtcgctg
tggacccgtggctcagcactggtgtcggcgatgtggggggtcgcgacgctgatcggaccg
gcgaccggaggccttttcgcgcagctcgggctgtggcgatgggcgttcggcgtgatgacg
ttgctgaccgcgttgatggccatgttggtgccggtcgcgctcggtgccgggggggtcggc
ccgggcggcgagacgccggtgggcagcacacacaaggtgccggtgtggtcgctattgctg
atgggggccgccgcactggcgatcagcgtcgccgcgcttccgaactacctcgtccagacg
gccgggctgctagccgccgccgcgctgctggttgcggtgtttgtggtagtcgactggcgg
atacacgcagcggtgttgccgcccagcgtatttggctccggaccgttgaaatggatttac
ctgaccatgtcggtgcagatgattgcggcaatggtcgatacctacgtgccgctgttcggt
cagcgactgggacacctgaccccggtggcagccgggttcttgggtgccgcgctggcggtg
ggctggacggtcggtgaggtcgccagcgcctcgttgaacagtgcacgagttatcgggcat
gtcgtggcagccgcaccgctggtgatggcgtcggggttggcgctaggcgccgtcacccag
cgcgccgatgcgccggtggggatcatcgcgctgtgggcgctggcgctgctgatcatcggg
accggcatcgggatcgcctggccgcatctaacggtgcgcgctatggattctgtcgccgac
ccggccgagagcagcgcggcggccgcggcgatcaatgtcgtacagctgatctccggtgct
ttcggcgccgggctggccggtgtggtggtcaacactgccaagggcggcgaagtggcggcg
gctcgtgggctatacatggcatttacggtgctggccgccgctggtgtcatcgcctcctac
caggccacgcaccgcgaccggcgcttaccgcgttga

DBGET integrated database retrieval system