KEGG   Mycobacterium tuberculosis H37Rv: Rv1819c
Entry
Rv1819c           CDS       T00015                                 

Gene name
bacA
Definition
(RefSeq) vitamin B12 transport ATP-binding protein BacA
  KO
K02471  vitamin B12/bleomycin/antimicrobial peptide transport system ATP-binding/permease protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rv1819c (bacA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv1819c (bacA)
Transporters [BR:mtu02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Other ABC transporters
    Rv1819c (bacA)
SSDB
Motif
Pfam: ABC_membrane_2 SbmA_BacA ABC_tran AAA_16 AAA_22 AAA_29 NACHT AAA_30 AAA_25 AAA_23 AAA_21 AAA_28 RsgA_GTPase cobW AAA_18 NTPase_1 TsaE
Other DBs
NCBI-GeneID: 885539
NCBI-ProteinID: NP_216335
TubercuList: Rv1819c
UniProt: P9WQI9
Position
complement(2062809..2064728)
AA seq 639 aa
MGPKLFKPSIDWSRAFPDSVYWVGKAWTISAICVLAILVLLRYLTPWGRQFWRITRAYFV
GPNSVRVWLMLGVLLLSVVLAVRLNVLFSYQGNDMYTALQKAFEGIASGDGTVKRSGVRG
FWMSIGVFSVMAVLHVTRVMADIYLTQRFIIAWRVWLTHHLTQDWLDGRAYYRDLFIDET
IDNPDQRIQQDVDIFTAGAGGTPNAPSNGTASTLLFGAVQSIISVISFTAILWNLSGTLN
IFGVSIPRAMFWTVLVYVFVATVISFIIGRPLIWLSFRNEKLNAAFRYALVRLRDAAEAV
GFYRGERVEGTQLQRRFTPVIDNYRRYVRRSIAFNGWNLSVSQTIVPLPWVIQAPRLFAG
QIDFGDVGQTATSFGNIHDSLSFFRNNYDAFASFRAAIIRLHGLVDANEKGRALPAVLTR
PSDDESVELNDIEVRTPAGDRLIDPLDVRLDRGGSLVITGRSGAGKTTLLRSLAELWPYA
SGTLHRPGGENETMFLSQLPYVPLGTLRDVVCYPNSAAAIPDATLRDTLTKVALAPLCDR
LDEERDWAKVLSPGEQQRVAFARILLTKPKAVFLDESTSALDTGLEFALYQLLRSELPDC
IVISVSHRPALERLHENQLELLGGGQWRLAPVEAAPAEV
NT seq 1920 nt   +upstreamnt  +downstreamnt
ttgggcccgaaattgtttaagccgtccatcgattggtctagagcattcccggattccgtg
tattgggtcggcaaagcctggacgatcagtgccatctgtgtgctcgcgatattggttctg
ctcaggtatttgacgccctggggccggcagttctggcggatcacccgcgcatacttcgtt
ggccccaacagcgttcgcgtgtggctgatgctcggcgtgttgttgctttcggtagtgctg
gcagtgcgcctgaatgtgctattcagctaccaaggcaacgacatgtacacggccttgcag
aaggccttcgagggcatcgcctctggcgatggcacggtcaaacgctcaggcgtgcgagga
ttttggatgtcgatcggggttttcagcgtgatggccgtgctgcacgtgacccgggtcatg
gccgacatctacttgacgcagcgcttcatcatcgcctggagggtctggctaacccaccac
ctcacacaagactggctcgacggcagggcctactaccgagacctgttcatcgacgaaacg
atcgacaaccccgaccagcgcattcagcaagacgtcgatatcttcaccgccggggcaggc
ggcactccgaatgctccctccaacgggacggccagcacgctgcttttcggggccgtgcag
tcgatcatttcggtgatttctttcacagcgatcctgtggaatctctcgggcaccctgaat
atcttcggcgtgtccatcccgcgcgcaatgttctggaccgtgctggtctatgtgttcgtg
gccacggtcatctcgttcatcatcgggcggcccctgatctggctcagcttccgcaatgaa
aagctcaatgccgctttccgttacgcgctggttcggctacgcgacgccgccgaggcggtg
ggtttctaccgcggcgagcgggtggaaggtacccagctacagcggcggttcacgccggtg
atcgacaattaccgtcgctacgttcggcgcagcatcgcattcaatggatggaatctgtcg
gtgagccagacaattgttccgttgccgtgggtcatccaggcgcctcgattattcgccggg
cagatcgacttcggcgatgtcgggcagacggcgacttccttcggcaacattcacgactcg
ttgtcgttcttccgcaacaactacgacgcgtttgcgtccttccgcgcagcaatcatccga
ttgcatgggctggtcgacgccaacgagaaaggccgcgccctgcccgcggtcctgacccga
ccgagcgacgacgagtccgtcgagctcaacgacatcgaggtgcgtacgcctgccggcgat
cggttgatcgacccgctcgatgtgcggctggaccgcggaggctcgctggtgatcaccggg
cgttctggggccggcaagaccacgctgctgcgcagtctggcggaactgtggccctacgca
tcggggaccctgcaccggccgggcggcgagaacgagacgatgttcttgtcgcagttgccg
tatgtgccgctggggacgctgcgtgacgtggtgtgctaccccaactctgcggccgccatc
cccgacgccaccctgcgggacacgctgaccaaggtggcgctggccccactgtgtgaccgg
ctggacgaggaacgcgactgggccaaggtgctctcccccggtgagcagcaacgtgttgcc
tttgctcgcatcctgctcaccaaacccaaggcggtcttcctcgacgaaagtacctcggcg
ctggacaccgggctggagtttgcgctctaccaattgctgcgcagcgagctgccggactgc
atcgtgatcagcgtcagccatcgccccgccctcgagcggctgcacgaaaaccagctcgaa
ctactcggtggcggccaatggcggctggccccagtcgaggcggcgcccgccgaagtgtaa

DBGET integrated database retrieval system