KEGG   Mycobacterium tuberculosis H37Rv: Rv1826
Entry
Rv1826            CDS       T00015                                 

Gene name
gcvH
Definition
(RefSeq) glycine cleavage system protein H
  KO
K02437  glycine cleavage system H protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1826 (gcvH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1826 (gcvH)
SSDB
Motif
Pfam: GCV_H Biotin_lipoyl RnfC_N
Other DBs
NCBI-GeneID: 885720
NCBI-ProteinID: NP_216342
TubercuList: Rv1826
UniProt: P9WN55
Structure
PDB: 
3HGB 3IFT

Position
2071952..2072356
AA seq 134 aa
MSDIPSDLHYTAEHEWIRRSGDDTVRVGITDYAQSALGDVVFVQLPVIGTAVTAGETFGE
VESTKSVSDLYAPISGKVSEVNSDLDGTPQLVNSDPYGAGWLLDIQVDSSDVAALESALT
TLLDAEAYRGTLTE
NT seq 405 nt   +upstreamnt  +downstreamnt
gtgagcgatatcccgtccgatctgcactacaccgccgaacacgagtggattcgccgcagt
ggcgacgacaccgtccgggtggggatcaccgactatgcacagtcggcgcttggcgacgtc
gttttcgttcagctacccgttatcggcaccgcggtcaccgccggcgagaccttcggcgaa
gtggaatcgacgaaatctgtgtcggatctctatgcgcccatttcgggtaaggtgtctgag
gtcaacagcgatctggacggcactccgcaattggtgaattccgacccctacggagccggc
tggctgctggacatccaggtcgacagctcggatgtcgctgccctggagtcagctttgacg
acactgctcgacgctgaggcctaccgcggcacactgaccgagtga

DBGET integrated database retrieval system