KEGG   Mycobacterium tuberculosis H37Rv: Rv1989cHelp
Entry
Rv1989c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RES
Motif
Other DBs
NCBI-GeneID: 885810
NCBI-ProteinID: NP_216505
TubercuList: Rv1989c
UniProt: P9WLP9
Structure
PDB: 

Position
complement(2232739..2233299)
Genome map
AA seq 186 aa AA seqDB search
MSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLA
DSAQACMVEVERAAQAASTTAEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDI
YGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQRTRPGQLQLRQSVDLTPALY
QELRAT
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatgccctcgatgaagggctcgtccagcgtatcgacgcacgcggaacaattgag
tggtcggaaacgtgctaccggtataccggcgcgcaccgtgacgccttgtccggtgagggc
gcgcgcagattcggaggcaggtggaatccgccgctgctctttccggcgatctatcttgct
gattccgcccaagcctgcatggttgaggtggaacgggcggcgcaagcggcttcaacgacc
gcagagaagatgctcgaggcggcctaccgactacacacgatcgacgtcacggacctggcc
gtcctcgatctgacaaccccgcaagctcgggaagccgtggggctcgagaacgacgacatc
tatggcgacgactggtcagggtgccaggcggtcggacatgcggcctggttcttgcacatg
caaggtgtcctcgtgccggcggcgggcggtgtcggcctcgttgtcaccgcgtatgaacag
cgaactcggccgggccaactacaactgcgacaaagcgtcgatctgacgcctgctctttac
caagaacttcgagccacgtag

DBGET integrated database retrieval system