KEGG   Mycobacterium tuberculosis H37Rv: Rv2203
Entry
Rv2203            CDS       T00015                                 

Definition
(RefSeq) membrane protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB
Motif
Pfam: PUFD
Other DBs
NCBI-GeneID: 888318
NCBI-ProteinID: NP_216719
TubercuList: Rv2203
UniProt: P9WLI7
Position
2468231..2468923
AA seq 230 aa
MPGPHSPNPGVGTNGPAPYPEPSSHEPQALDYPHDLGAAEPAFAPGPADDAALPPAAYPG
VPPQVSYPKRRHKRLLIGIVVALALVSAMTAAIIYGVRTNGANTAGTFSEGPAKTAIQGY
LNALENRDVDTIVRNALCGIHDGVRDKRSDQALAKLSSDAFRKQFSQVEVTSIDKIVYWS
QYQAQVLFTMQVTPAAGGPPRGQVQGIAQLLFQRGQVLVCSYVLRTAGSY
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcccggtccccactcgccgaaccccggtgtcggcaccaacggaccggcgccgtacccc
gagccctcatcccacgaaccccaagccctggactacccccacgacctcggcgccgccgaa
ccggccttcgccccgggaccggcagacgacgcggcgctgccgcccgccgcatatcccggc
gtgccgccgcaggtgtcctacccgaagcgacggcacaagcggctgctgatcggcattgtg
gtagccctcgcgctggtgtcggctatgacggcggcgatcatatacggggtccgcaccaac
ggagccaacacggcaggcacattctcggagggaccggccaaaaccgcgattcagggatac
ctcaacgcgctggagaaccgcgatgtggacaccatcgttcgcaatgcgctgtgcggtatc
cacgacggcgtgcgcgacaagcgctccgatcaggccttggccaagctgagcagcgacgcg
ttccgcaagcagttctcccaggtcgaagtgacctcgatcgacaaaatcgtgtactggtcg
caatatcaggcccaggtgctgttcaccatgcaggtgacacctgccgccggcggcccgcca
cgcggtcaggtgcaaggcatcgctcagttgcttttccagcgcggtcaggtcttggtgtgc
tcgtacgtgttgcgcaccgcggggtcgtactag

DBGET integrated database retrieval system