KEGG   Mycobacterium tuberculosis H37Rv: Rv2333cHelp
Entry
Rv2333c           CDS       T00015                                 

Gene name
stp
Definition
(RefSeq) multidrug resistance protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 DUF1198
Motif
Other DBs
NCBI-GeneID: 887274
NCBI-ProteinID: NP_216849
TubercuList: Rv2333c
UniProt: P9WG91
Position
complement(2606708..2608321)
Genome map
AA seq 537 aa AA seqDB search
MNRTQLLTLIATGLGLFMIFLDALIVNVALPDIQRSFAVGEDGLQWVVASYSLGMAVFIM
SAATLADLDGRRRWYLIGVSLFTLGSIACGLAPSIAVLTTARGAQGLGAAAVSVTSLALV
SAAFPEAKEKARAIGIWTAIASIGTTTGPTLGGLLVDQWGWRSIFYVNLPMGALVLFLTL
CYVEESCNERARRFDLSGQLLFIVAVGALVYAVIEGPQIGWTSVQTIVMLWTAAVGCALF
VWLERRSSNPMMDLTLFRDTSYALAIATICTVFFAVYGMLLLTTQFLQNVRGYTPSVTGL
MILPFSAAVAIVSPLVGHLVGRIGARVPILAGLCMLMLGLLMLIFSEHRSSALVLVGLGL
CGSGVALCLTPITTVAMTAVPAERAGMASGIMSAQRAIGSTIGFAVLGSVLAAWLSATLE
PHLERAVPDPVQRHVLAEIIIDSANPRAHVGGIVPRRHIEHRDPVAIAEEDFIEGIRVAL
LVATATLAVVFLAGWRWFPRDVHTAGSDLSERLPTAMTVECAVSHMPGATWCRLWPA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcacgcagctcctcacgctcatcgccactggcctgggcctgttcatgatcttt
ctcgacgcactgatcgtgaacgtggcgctgcccgacatccagcgcagtttcgcggtgggg
gaggacggcctgcagtgggtggtggcgtcctacagcctcggaatggcggtcttcatcatg
tcggcggcgacgcttgccgacctcgacggtcggcgccgctggtacttgataggtgtttcg
ttgttcacgctgggatctatcgcctgcgggttggcgccctcaatcgcggtgctcaccacc
gcgcggggcgcgcagggcctaggtgcggcggccgtcagcgtaacctcgctcgccctggtc
agcgcggcctttccggaggcgaaggagaaggcgcgcgccatcgggatctggaccgccatc
gcgagcatcggtacgacgacgggcccgacactgggcggtctgctggtggaccagtggggg
tggcgcagcatcttctatgtcaacctgcccatgggcgcactcgtcctcttcctgactttg
tgctacgtcgaggagtcgtgtaacgagcgggcacgccgcttcgatctgtccgggcagctg
ctgttcatcgttgccgtgggtgccctggtgtatgcggtcatcgaaggcccccagatcggc
tggacgtctgtccagaccatcgtgatgctctggacagccgccgtcggctgcgccctgttc
gtctggcttgagcgcagatcatcgaatccgatgatggatctgaccctgttccgcgacacc
tcatacgccctggccatcgcgaccatctgcacggtgttcttcgccgtctatgggatgctg
ctgctcaccacccagttcctgcagaacgtgcgcggctataccccgagcgtgaccggcctg
atgatccttccgttcagtgcggccgtggccatcgtgtcgccacttgttgggcacctggtt
ggccggatcggagcacgcgttcccatcctggcggggctgtgcatgttgatgctgggtctg
ctcatgctcatcttcagcgagcaccggagctcggccctggtcctggtcgggctgggcttg
tgcgggagcggcgtcgcgttgtgcctgacgccgatcacgaccgtcgccatgaccgcggtc
cccgccgagcgtgcgggcatggcgtccggcatcatgagtgctcagcgggcgatcggctcg
acgatcgggttcgcggttttgggctccgtccttgccgcctggctttcggccacactcgag
ccccatctggagcgcgcggtgcccgacccggtccagcgccacgtccttgccgagatcatt
atcgacagtgccaatccgcgagcgcatgtgggcggaatcgtcccccggcggcacattgag
catcgcgaccccgtcgcgattgcggaggaggatttcatcgaaggcattcgggtggcgttg
ctcgtcgccactgcaacactggctgtcgtgtttctcgccggctggcgatggtttccgcgt
gacgtgcacaccgcgggcagcgacctaagcgagaggctgcctacagcgatgaccgtcgag
tgcgcggttagtcatatgccgggagccacatggtgtcgactatggcctgcctga

DBGET integrated database retrieval system