KEGG   Mycobacterium tuberculosis H37Rv: Rv2397c
Entry
Rv2397c           CDS       T00015                                 
Symbol
cysA1
Name
(RefSeq) sulfate ABC transporter ATP-binding protein CysA
  KO
K02045  sulfate/thiosulfate transport system ATP-binding protein [EC:7.3.2.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00920  Sulfur metabolism
mtu02010  ABC transporters
Module
mtu_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Rv2397c (cysA1)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rv2397c (cysA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv2397c (cysA1)
Enzymes [BR:mtu01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.3  ABC-type sulfate transporter
     Rv2397c (cysA1)
Transporters [BR:mtu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    Rv2397c (cysA1)
SSDB
Motif
Pfam: ABC_tran TOBE_3 AAA_21 TOBE SMC_N TOBE_2 AAA_22 TniB AAA_16 AAA_29 RsgA_GTPase AAA_23 AAA_25 SbcC_Walker_B NACHT AAA AAA_33 AAA_30 AAA_27 MMR_HSR1 AAA_24
Other DBs
NCBI-GeneID: 885663
NCBI-ProteinID: YP_177879
TubercuList: Rv2397c
UniProt: P9WQM1
Position
complement(2693909..2694964)
AA seq 351 aa
MTYAIVVADATKRYGDFVALDHVDFVVPTGSLTALLGPSGSGKSTLLRTIAGLDQPDTGT
ITINGRDVTRVPPQRRGIGFVFQHYAAFKHLTVRDNVAFGLKIRKRPKAEIKAKVDNLLQ
VVGLSGFQSRYPNQLSGGQRQRMALARALAVDPEVLLLDEPFGALDAKVREELRAWLRRL
HDEVHVTTVLVTHDQAEALDVADRIAVLHKGRIEQVGSPTDVYDAPANAFVMSFLGAVST
LNGSLVRPHDIRVGRTPNMAVAAADGTAGSTGVLRAVVDRVVVLGFEVRVELTSAATGGA
FTAQITRGDAEALALREGDTVYVRATRVPPIAGGVSGVDDAGVERVKVTST
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgacctacgccatcgtcgtggccgacgccaccaaacgctacggcgacttcgtcgcactt
gaccacgtggatttcgtcgtaccgaccggttcgctgaccgcattgttgggccccagcggt
tcgggcaagtcgacgctgttgcgcaccatagccggcctcgaccaaccggacaccggaacc
atcacgatcaacggccgcgacgtcacccgggtgccgccacagcggcgtggcatcggattc
gtcttccagcactacgcggcgttcaaacacctgactgtccgtgacaacgtggcgttcggg
ttgaagatccgtaagcgccccaaggccgagatcaaggccaaggtcgacaatctgctgcag
gtggtgggcctgagcggatttcagagccgctaccccaatcagctctccggtgggcaacga
cagcggatggcgctggccagggcgctggcggtcgatccggaggtgctgctgctcgacgag
ccgttcggcgcactcgatgccaaggtgcgcgaagagctgcgtgcctggctgcgccgcctg
cacgacgaggtgcatgtcaccacggtgctggtcacccacgatcaggccgaagcgctggat
gtggccgaccgcatcgccgtactccacaagggccgtatcgagcaggtcggatccccgacc
gacgtttacgacgccccggcgaacgccttcgtgatgtccttcttgggagcggtttccacg
ttgaacggctccctggtgcgcccgcacgacatccgggtcggccggactcccaatatggcc
gtggccgccgctgacggcaccgccgggtccaccggtgtgctacgggctgttgtggatcgg
gtggtggtgctgggcttcgaggtccgcgtggagttgaccagcgcggccaccggcggggcc
ttcaccgcccagatcacccgcggcgatgccgaggcgctggccctacgcgagggtgacacc
gtctacgtgcgtgccacccgggtgccgccgattgccggtggcgtatcgggcgtcgacgat
gccggcgtggaacgggtcaaagtcacatcgacgtga

DBGET integrated database retrieval system