KEGG   Mycobacterium tuberculosis H37Rv: Rv2399c
Entry
Rv2399c           CDS       T00015                                 

Gene name
cysT
Definition
(RefSeq) sulfate ABC transporter permease CysT
  KO
K02046  sulfate/thiosulfate transport system permease protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00920  Sulfur metabolism
mtu02010  ABC transporters
Module
mtu_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Rv2399c (cysT)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rv2399c (cysT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv2399c (cysT)
Transporters [BR:mtu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    Rv2399c (cysT)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 885301
NCBI-ProteinID: NP_216915
TubercuList: Rv2399c
UniProt: P71745
Position
complement(2695796..2696647)
AA seq 283 aa
MTESLVGERRAPQFRARLSGPAGPPSVRVGMAVVWLSVIVLLPLAAIVWQAAGGGWRAFW
LAVSSHAAMESFRVTLTISTAVTVINLVFGLLIAWVLVRDDFAGKRIVDAIIDLPFALPT
IVASLVMLALYGNNSPVGLHFQHTATGVGVALAFVTLPFVVRAVQPVLLEIDRETEEAAA
SLGANGAKIFTSVVLPSLTPALLSGAGLAFSRAIGEFGSVVLIGGAVPGKTEVSSQWIRT
LIENDDRTGAAAISVVLLSISFIVLLILRVVGARAAKREEMAA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgacggaatcgttggtcggcgaacgccgcgcgccgcagttccgcgcgcgcctttccggc
cccgcgggccccccttccgttcgggtcggtatggcagtggtgtggctttcggtgatcgtg
ctgttgccgctggccgccatcgtctggcaggccgcgggcggtggttggcgggccttctgg
ctggcggtctcgtcgcatgccgcgatggagtcgttccgggtaacgctgacgatttcgacc
gcagtcacggtcatcaacctggtgttcggcttgctgatcgcctgggtgctggtgcgtgac
gacttcgctggcaagcggatcgtcgatgcgattatcgatctgccgtttgcgttgcccacc
atcgtcgccagcctggtgatgttggcactgtacgggaacaacagcccggtggggcttcat
tttcaacacaccgcgaccggtgttggggtggcgttggcgttcgtcacattgccgttcgtg
gtgcgcgccgtgcagccggtgctgctggaaatcgatcgcgagaccgaggaggcggcggcg
tcgctgggcgctaatggtgccaaaatcttcacttcggtggtgttgccgtcgctgacgccg
gcattgttatccggtgcgggcctggcgttttcgcgcgctatcggcgagttcggttcggtg
gttctgatcggcggggccgtgccgggcaagaccgaggtgtcctcgcaatggattcgcacc
ctgatcgagaacgacgaccgcaccggagcggccgcgatatcggttgtattgctctcgatt
tcgttcattgtgctgctcatcctacgtgtcgtcggcgcgcgtgcggccaaacgtgaggag
atggccgcatga

DBGET integrated database retrieval system