KEGG   Mycobacterium tuberculosis H37Rv: Rv2456c
Entry
Rv2456c           CDS       T00015                                 

Name
(RefSeq) MFS-type transporter
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB
Motif
Pfam: MFS_1 MFS_1_like
Other DBs
NCBI-GeneID: 887340
NCBI-ProteinID: NP_216972
TubercuList: Rv2456c
UniProt: P9WJX1
Position
complement(2756936..2758192)
AA seq 418 aa
MSGTVVAVPPRVARALDLLNFSLADVRDGLGPYLSIYLLLIHDWDQASIGFVMAVGGIAA
IVAQTPIGALVDRTTAKRALVVAGAVLVTAAAVAMPLFAGLYSISVLQAVTGIASSVFAP
ALAAITLGAVGPQFFARRIGRNEAFNHAGNASAAGATGALAYFFGPVVVFWVLAGMALIS
VLATLRIPPDAVDHDLARGMDHAPGEPHPQPSRFTVLAHNRELVIFGAAVVAFHFANAAM
LPLVGELLALHNRDEGTALMSSCIVAAQVVMVPVAYVVGTRADAWGRKPIFLVGFAVLTA
RGFLYTLSDNSYWLVGVQLLDGIGAGIFGALFPLVVQDVTHGTGHFNISLGAVTTATGIG
AALSNLVAGWIVVVAGYDAAFMSLGALAGAGFLLYLVAMPETVDSDVRVRSRPTLGGK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtcgggcaccgttgtggcagtgccgccacgggtggcgcgtgcgctggacctgctgaat
ttctcgttggctgatgttcgcgacggtctgggcccctatctgtcgatatacctcctgttg
atccacgattgggatcaagcctcgatcgggttcgtcatggcggtcggcggcattgcggcc
atcgtggcccagacgccgattggcgccctggtggaccggaccacggccaagcgggcgctg
gtcgtcgccggcgcggtgctggtcaccgccgccgcagtggcgatgccgctgtttgcgggc
ttgtattccatctcggtgctgcaggccgtcaccgggatcgccagctcggttttcgctccg
gcgttggcggcgatcacgttgggtgctgtcggtcctcagtttttcgccagacggattggg
cgtaacgaagcgttcaaccacgccggtaacgcgtcggcggctggggcgaccggcgcgctg
gcgtacttcttcgggccggtggtggtgttctgggtgctggccggcatggcgttgatcagc
gtgctggcgacactgcggatcccgccggacgcggtcgaccacgatttagcgcgtggtatg
gaccatgcgcccggcgagccgcatccgcagccgtcgcggttcaccgtgttggcgcacaac
cgcgaactggtgatcttcggggcggcggttgtcgcgttccacttcgccaacgcggcgatg
ctgccgctggtcggcgagctgttggcgttgcacaatcgagacgaaggaacggcgctgatg
tcgtcgtgcatcgtcgcggcgcaggtcgtgatggtgccggtggcgtatgtggtcgggacc
agggccgacgcgtgggggcgaaagccgatctttttggtggggttcgctgtcttgaccgct
cgcgggttcctctacacgttgtcggataactcctactggctggtgggcgtgcagttgctc
gacggtatcggagccggcattttcggggcgttgtttccccttgtcgtacaggacgtcaca
cacggaacgggacatttcaatatcagcctcggggcggtaaccacggcaacgggcattggt
gccgcgctgtctaatcttgttgccggctggatcgtggtcgtcgcgggctatgacgcggca
ttcatgtcgctgggtgcgctcgccggggccggcttcctcctgtacctggtcgcgatgccg
gaaaccgtggattcggatgtccgggtgcggtcgcggccaaccctcggggggaagtga

DBGET integrated database retrieval system