KEGG   Mycobacterium tuberculosis H37Rv: Rv2737cHelp
Entry
Rv2737c           CDS       T00015                                 

Gene name
recA
Definition
(RefSeq) recombinase A
  KO
K03553  recombination protein RecA
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Rv2737c (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mtu03400]
    Rv2737c (recA)
DNA repair and recombination proteins [BR:mtu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Rv2737c (recA)
    RecFOR pathway proteins
     Rv2737c (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Rv2737c (recA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecA LAGLIDADG_3 Intein_splicing Rad51 ATPase AAA_24 ATPase_2 AAA_25 CobU AAA
Motif
Other DBs
NCBI-GeneID: 888371
NCBI-ProteinID: NP_217253
TubercuList: Rv2737c
UniProt: P9WHJ3
Structure
PDB: 

Position
complement(3049052..3051424)
Genome map
AA seq 790 aa AA seqDB search
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRG
RVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQP
DTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMT
GALNNSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVG
NRTRVKVVKNKCLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWF
DQGTRDVIGLRIAGGAIVWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIP
ADHARLLGYLIGDGRDGWVGGKTPINFINVQRALIDDVTRIAATLGCAAHPQGRISLAIA
HRPGERNGVADLCQQAGIYGKLAWEKTIPNWFFEPDIAADIVGNLLFGLFESDGWVSREQ
TGALRVGYTTTSEQLAHQIHWLLLRFGVGSTVRDYDPTQKRPSIVNGRRIQSKRQVFEVR
ISGMDNVTAFAESVPMWGPRGAALIQAIPEATQGRRRGSQATYLAAEMTDAVLNYLDERG
VTAQEAAAMIGVASGDPRGGMKQVLGASRLRRDRVQALADALDDKFLHDMLAEELRYSVI
REVLPTRRARTFDLEVEELHTLVAEGVVVHNCSPPFKQAEFDILYGKGISREGSLIDMGV
DQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGAVVTDDPSN
DGVLPAPVDF
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagacccccgatcgggaaaaggcgctcgagctggcagtggcccagatcgagaag
agttacggcaaaggttcggtgatgcgcctcggcgacgaggcgcgtcagccgatttcggtc
attccgaccggatccatcgcactagacgtggccctgggcattggcggcctgccgcgtggc
cgggtgatagagatatacggcccggagtcgtcgggtaagaccaccgtggcgctgcacgcg
gtggccaacgctcaggccgccggtggtgttgcggcgttcatcgacgccgagcacgcgctg
gatccggactatgccaagaagctcggtgtcgacaccgattcgctgctggtcagccagccg
gacaccggggaacaggcactcgagatcgccgacatgctgatccgctcgggtgcgcttgac
atcgtggtgatcgactcggtggcggcgctggtgccgcgcgcggagctcgaaggcgagatg
ggcgacagccacgtcgggctgcaggcccggctgatgagccaggcgctgcggaaaatgacc
ggcgcgctgaataattcgggcaccacggcgatcttcatcaaccagctccgcgacaagatc
ggagtgatgttcgggtcgcccgagacgacaacgggcggaaaggcgttgaagttctacgcg
tcggtgcgcatggacgtgcggcgagtcgagacgctcaaggacggtaccaacgcggtcggc
aaccgcacccgggtcaaggtcgtcaagaacaagtgcctcgcagagggcactcggatcttc
gatccggtcaccggtacaacgcatcgcatcgaggatgttgtcgatgggcgcaagcctatt
catgtcgtggctgctgccaaggacggaacgctgcatgcgcggcccgtggtgtcctggttc
gaccagggaacgcgggatgtgatcgggttgcggatcgccggtggcgccatcgtgtgggcg
acacccgatcacaaggtgctgacagagtacggctggcgtgccgccggggaactccgcaag
ggagacagggtggcgcaaccgcgacgcttcgatggattcggtgacagtgcgccgattccg
gcggatcatgcccggctgcttggctacctgatcggagatggcagggatggttgggtgggg
ggcaagactccgatcaacttcatcaatgttcagcgggcgctcattgacgacgtgacgcga
atcgctgcgacgctcggttgcgcggcccatccgcaggggcgtatctcactcgcgatcgct
catcgacccggtgagcgcaacggtgtggcagacctttgtcagcaggccggtatctacggc
aagctcgcgtgggagaagacgattccgaattggttcttcgagccggacatcgcggccgac
attgtcggcaatctgctcttcggcctgttcgaaagcgacgggtgggtgagccgggaacag
accggggcacttcgggtcggttacacgacgacctctgaacaactcgcgcatcagattcat
tggctgctgctgcggttcggtgtcgggagcaccgttcgagattacgatccgacccagaag
cggccgagcatcgtcaacggtcgacggatccagagcaaacgtcaagtgttcgaggtccgg
atctcgggtatggataacgtcacggcattcgcggagtcagttcccatgtgggggccgcgc
ggtgccgcgcttatccaggcgattccagaagccacgcaggggcggcgtcgtggatcgcaa
gcgacatatctggctgcagagatgaccgatgccgtgctgaattatctggacgagcgcggc
gtgaccgcgcaggaggccgcggccatgatcggtgtagcttccggggacccccgcggtgga
atgaagcaggtcttaggtgccagccgccttcgtcgggatcgcgtgcaggcgctcgcggat
gccctggatgacaaattcctgcacgacatgctggcggaagaactccgctattccgtgatc
cgagaagtgctgccaacgcggcgggcacgaacgttcgacctcgaggtcgaggaactgcac
accctcgtcgccgaaggggttgtcgtgcacaactgttcgccccccttcaagcaggccgag
ttcgacatcctctacggcaagggaatcagcagggagggctcgctgatcgacatgggtgtg
gatcagggcctcatccgcaagtcgggtgcctggttcacctacgagggcgagcagctcggc
cagggcaaggagaatgcccgcaacttcttggtggagaacgccgacgtggctgacgagatc
gagaagaagatcaaggaaaagcttggcattggtgccgtggtgaccgatgatccctcaaat
gacggtgtcctgcccgcccccgtcgacttctga

DBGET integrated database retrieval system