KEGG   Mycobacterium tuberculosis H37Rv: Rv2882c
Entry
Rv2882c           CDS       T00015                                 

Gene name
frr
Definition
(RefSeq) ribosome recycling factor
  KO
K02838  ribosome recycling factor
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mtu03012]
    Rv2882c (frr)
Translation factors [BR:mtu03012]
 Eukaryotic type
  Release factors
   Rv2882c (frr)
 Prokaryotic type
   Rv2882c (frr)
SSDB
Motif
Pfam: RRF Phage_TAC_4
Other DBs
NCBI-GeneID: 887464
NCBI-ProteinID: NP_217398
TubercuList: Rv2882c
UniProt: P9WGY1
Structure
PDB: 

Position
complement(3191644..3192201)
AA seq 185 aa
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVP
EARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHK
GEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEG
ELLEV
NT seq 558 nt   +upstreamnt  +downstreamnt
atgattgatgaggctctcttcgacgccgaagagaaaatggagaaggctgtggcggtggca
cgtgacgacctgtcaactatccgtaccggccgcgccaaccctggcatgttctctcggatc
accatcgactactacggtgcggccaccccgatcacgcaactggccagcatcaatgtcccc
gaggcgcggctagtcgtgataaagccgtatgaagccaatcagttgcgcgctatcgagact
gcaattcgcaactccgaccttggagtgaatcccaccaacgacggcgcccttattcgcgtg
gccgtaccgcagctcaccgaagaacgtcggcgagagctggtcaaacaggcaaagcataag
ggggaggaggccaaggtttcggtgcgtaatatccgtcgcaaagcgatggaggaactccat
cgcatccgtaaggaaggcgaggccggcgaggatgaggtcggtcgcgcagaaaaggatctc
gacaagaccacgcaccaatacgtcacccaaattgatgagctggttaaacacaaagaaggc
gagctgctggaggtctag

DBGET integrated database retrieval system