KEGG   Mycobacterium tuberculosis H37Rv: Rv3014cHelp
Entry
Rv3014c           CDS       T00015                                 

Gene name
ligA
Definition
(RefSeq) DNA ligase A
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu03030  DNA replication
mtu03410  Base excision repair
mtu03420  Nucleotide excision repair
mtu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Rv3014c (ligA)
   03410 Base excision repair
    Rv3014c (ligA)
   03420 Nucleotide excision repair
    Rv3014c (ligA)
   03430 Mismatch repair
    Rv3014c (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mtu03032]
    Rv3014c (ligA)
   03400 DNA repair and recombination proteins [BR:mtu03400]
    Rv3014c (ligA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     Rv3014c (ligA)
DNA replication proteins [BR:mtu03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     Rv3014c (ligA)
DNA repair and recombination proteins [BR:mtu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     Rv3014c (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Rv3014c (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     Rv3014c (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rv3014c (ligA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 PTCB-BRCT DNA_ligase_ZBD HHH Auto_anti-p27
Motif
Other DBs
NCBI-GeneID: 887354
NCBI-ProteinID: NP_217530
TubercuList: Rv3014c
UniProt: P9WNV1
Structure
PDB: 

Position
complement(3372545..3374620)
Genome map
AA seq 691 aa AA seqDB search
MSSPDADQTAPEVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPE
LRTPDSPTQLVGGAGFATDFEPVDHLERMLSLDNAFTADELAAWAGRIHAEVGDAAHYLC
ELKIDGVALSLVYREGRLTRASTRGDGRTGEDVTLNARTIADVPERLTPGDDYPVPEVLE
VRGEVFFRLDDFQALNASLVEEGKAPFANPRNSAAGSLRQKDPAVTARRRLRMICHGLGH
VEGFRPATLHQAYLALRAWGLPVSEHTTLATDLAGVRERIDYWGEHRHEVDHEIDGVVVK
VDEVALQRRLGSTSRAPRWAIAYKYPPEEAQTKLLDIRVNVGRTGRITPFAFMTPVKVAG
STVGQATLHNASEIKRKGVLIGDTVVIRKAGDVIPEVLGPVVELRDGSEREFIMPTTCPE
CGSPLAPEKEGDADIRCPNARGCPGQLRERVFHVASRNGLDIEVLGYEAGVALLQAKVIA
DEGELFALTERDLLRTDLFRTKAGELSANGKRLLVNLDKAKAAPLWRVLVALSIRHVGPT
AARALATEFGSLDAIAAASTDQLAAVEGVGPTIAAAVTEWFAVDWHREIVDKWRAAGVRM
VDERDESVPRTLAGLTIVVTGSLTGFSRDDAKEAIVARGGKAAGSVSKKTNYVVAGDSPG
SKYDKAVELGVPILDEDGFRRLLADGPASRT
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccccagacgccgatcagaccgctcccgaggtgttgcggcagtggcaggcactg
gccgaggaggtgcgtgagcaccagttccgttattacgtgcgggacgcgccgatcatcagc
gacgcggaattcgacgagctgctgcgccgtctggaagccctcgaggagcagcatcccgag
ctgcgcacgcccgattcgccgacccagctggtcggcggtgccggcttcgccacggatttc
gagcccgtcgaccatctcgaacgaatgctcagcctcgacaacgcgttcaccgccgacgaa
ctcgccgcctgggccggccgcatccatgccgaggtcggagacgccgcacattacctgtgt
gagctcaagatcgacggcgtcgcgctgtctttggtctaccgcgagggacggctgacccgg
gcctccacccgcggcgacgggcgcaccggcgaggacgtcaccctgaacgcccggaccatc
gccgacgttcccgaacggctcacccccggcgacgactacccggtgcccgaggtcctcgag
gtccgcggcgaggtcttcttccggctggacgacttccaggcgctcaacgccagcctcgtc
gaggagggcaaggcgccgttcgccaacccccgcaacagcgcggcgggatcgctgcgccag
aaagacccggcggtcaccgcgcgccgccggctgcggatgatctgccacgggctgggccac
gtggagggctttcgcccggccaccctgcatcaggcatacctggcgttgcgggcatgggga
ctgccggtttccgaacacaccaccctggcaaccgacctggccggtgtgcgcgagcgcatc
gactactggggcgagcaccgccacgaggtggaccacgaaatcgacggcgtggtggtcaaa
gtcgacgaggtggcgttgcagcgcaggctgggttccacgtcgcgggcgccgcgctgggcc
atcgcctacaagtacccgcccgaggaagcgcagaccaagctgctcgacatccgggtgaac
gtcggccgcaccgggcggatcacgccgtttgcgttcatgacgccggtgaaggtggccggg
tcgacggtgggacaggccaccctgcacaacgcctcggagatcaagcgcaagggcgtgctg
atcggcgacaccgtggtgatccgcaaggccggcgacgtgatccccgaggtgctgggaccc
gtcgtcgaactgcgcgatggctccgaacgcgaattcatcatgcccaccacctgcccggag
tgcggttcgccgttggcgccggagaaggaaggcgacgccgacatccgttgccccaacgcc
cgcggctgcccggggcaactgcgggagcgggttttccacgtcgccagccgcaacggccta
gacatcgaggtgctcggttacgaggcgggtgtggcgctcttgcaggcgaaggtgatcgcc
gacgagggcgagctgttcgcgctgaccgagcgggacttgctgcgcaccgacctgttccga
accaaggcaggcgaactgtcggccaacggcaaacggctgctggtcaacctcgacaaggcc
aaggcggcaccgctgtggcgggtgctggtggcgctgtccatccgccatgtcgggccgacg
gcggcccgcgccctggccaccgagttcggcagccttgacgccatcgccgcggcgtccacc
gaccagctggccgccgtcgagggggtggggccgaccattgccgccgcggtcaccgagtgg
ttcgccgtcgactggcaccgcgagatcgtcgacaagtggcgggccgccggggtgcgaatg
gtcgacgagcgtgacgagagtgtgccacgcacgctggccgggctgaccatcgtggtcacc
ggctcgctgaccggtttctcccgcgacgacgccaaggaggcgatcgtggcccgcggcggc
aaggccgccggctcggtgtcgaagaagaccaactatgtcgtcgccggagactcgccggga
tccaaatacgacaaggcggtggagttgggggtgccgattctggacgaggatgggttccgg
agactgctggccgacggacccgcgtcacgaacgtaa

DBGET integrated database retrieval system