KEGG   Mycobacterium tuberculosis H37Rv: Rv3149Help
Entry
Rv3149            CDS       T00015                                 

Gene name
nuoE
Definition
(RefSeq) NADH-quinone oxidoreductase subunit E
  KO
K00334  NADH-quinone oxidoreductase subunit E [EC:1.6.5.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00190  Oxidative phosphorylation
mtu01100  Metabolic pathways
Module
mtu_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rv3149 (nuoE)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Rv3149 (nuoE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2Fe-2S_thioredx DUF3653
Motif
Other DBs
NCBI-GeneID: 887903
NCBI-ProteinID: NP_217665
TubercuList: Rv3149
UniProt: P9WIV5 I6X6I2
Position
3514657..3515415
Genome map
AA seq 252 aa AA seqDB search
MTQPPGQPVFIRLGPPPDEPNQFVVEGAPRSYPPDVLARLEVDAKEIIGRYPDRRSALLP
LLHLVQGEDSYLTPAGLRFCADQLGLTGAEVSAVASFYTMYRRRPTGEYLVGVCTNTLCA
VMGGDAIFDRLKEHLGVGHDETTSDGVVTLQHIECNAACDYAPVVMVNWEFFDNQTPESA
RELVDSLRSDTPKAPTRGAPLCGFRQTSRILAGLPDQRPDEGQGGPGAPTLAGLQVARKN
DMQAPPTPGADE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgacacagccacccggtcagccggtgttcatccggctcggaccgccaccggacgaaccc
aaccagtttgtcgtcgagggcgctccgcggtcgtatccgccggacgtactggcgcggctg
gaggtcgacgccaaggagatcatcggccgctatcccgacaggcgctcggcgctgttgccg
ttgctgcacctggtgcagggcgaggattcctacctgacgccggcgggtttgcggttctgc
gccgatcaactcgggctgaccggggccgaggtgtcggcggtggccagcttctacaccatg
taccgccggcgccccaccggcgagtacctggtgggtgtgtgcacgaacacgctgtgcgcc
gtcatgggcggcgacgccatcttcgaccgcctcaaagagcatctcggcgtcggccacgac
gaaaccacctccgacggtgtggtcaccttgcaacacatcgaatgcaacgccgcctgcgat
tacgcaccggtggtgatggtcaactgggaattcttcgacaaccagacgccggagtccgcg
cgcgaactcgtcgactcgctgcgctccgacacaccgaaggcgcccacccgcggcgcgccg
ctgtgcggcttccggcaaacatcgcgcatcctggcgggtctacccgaccagcgtcccgac
gaaggccagggcggtcccggcgcgcccaccctggccgggctgcaggtggcaaggaagaac
gacatgcaggcgccaccaacccccggagcggacgaatga

DBGET integrated database retrieval system