KEGG   Mycobacterium tuberculosis H37Rv: Rv3158Help
Entry
Rv3158            CDS       T00015                                 

Gene name
nuoN
Definition
(RefSeq) NADH-quinone oxidoreductase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:1.6.5.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00190  Oxidative phosphorylation
mtu01100  Metabolic pathways
Module
mtu_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Rv3158 (nuoN)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Rv3158 (nuoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M
Motif
Other DBs
NCBI-GeneID: 888780
NCBI-ProteinID: NP_217674
TubercuList: Rv3158
UniProt: P9WIW9 I6YFE5
Position
3525790..3527385
Genome map
AA seq 531 aa AA seqDB search
MILPAPHVEYFLLAPMLIVFSVAVAGVLAEAFLPRRWRYGAQVTLALGGSAVALIAVIVV
ARSIHGSGHAAVLGAIAVDRATLFLQGTVLLVTIMAVVFMAERSARVSPQRQNTLAVARL
PGLDSFTPQASAVPGSDAERQAERAGATQTELFPLAMLSVGGMMVFPASNDLLTMFVALE
VLSLPLYLMCGLARNRRLLSQEAAMKYFLLGAFSSAFFLYGVALLYGATGTLTLPGIRDA
LAARTDDSMALAGVALLAVGLLFKVGAVPFHSWIPDVYQGAPTPITGFMAAATKVAAFGA
LLRVVYVALPPLHDQWRPVLWAIAILTMTVGTVTAVNQTNVKRMLAYSSVAHVGFILTGV
IADNPAGLSATLFYLVAYSFSTMGAFAIVGLVRGADGSAGSEDADLSHWAGLGQRSPIVG
VMLSMFLLAFAGIPLTSGFVSKFAVFRAAASAGAVPLVIVGVISSGVAAYFYVRVIVSMF
FTEESGDTPHVAAPGVLSKAAIAVCTVVTVVLGIAPQPVLDLADQAAQLLR
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcccgccccgcacgtcgagtacttcctgctcgctccgatgctcatcgtcttt
tcggttgcggtcgccggtgtgctggccgaggctttcctgccgcgccggtggcgctatggc
gcccaagtgacgctcgcccttggcgggtcggcagtggcactcatcgcggtcatcgtggtg
gccaggtcgattcacgggtcgggtcacgccgcggtgctgggggccatagccgtggatcga
gcgaccctgtttctgcaaggcaccgtactactggtcacgatcatggcagtcgtcttcatg
gccgaacgcagcgcccgggtgagtccgcaacgccagaacaccctcgctgtggcgcggctc
cctggactcgattcgtttaccccgcaggcttccgccgtgcccggcagcgatgctgagcgc
caagcggaacgggcgggagccacccagacggaacttttcccgctggcgatgctgtccgtc
ggcggcatgatggtgtttcccgcgtccaacgacctgttgacgatgttcgttgcgctggag
gtgctatcgctgccgctgtacctgatgtgtgggctggcccggaatcgccgcctgctgtcg
caggaagccgcgatgaagtacttcctgctgggcgccttctcgtcggcgttcttcctctac
ggcgtcgcgttgctatacggcgcgaccggcacgctgaccttgccgggtattcgggatgcg
ttggcagcgcgcaccgacgactcaatggcgttggccggcgtcgcgctgctcgcggtcggc
ctactattcaaggtcggcgcggtgccattccactcctggattcccgatgtgtaccagggc
gcacccaccccgatcaccgggttcatggcggccgccaccaaggtcgcggcgttcggtgcg
ctgctccgggtggtctatgtcgcgctgccgccgctgcacgatcagtggcgcccggtgctg
tgggcgattgccatcctcaccatgacggtgggcaccgtcaccgcggtaaaccagaccaac
gtcaagcgtatgctggcctattcatcggtcgcgcacgtcggtttcatacttaccggcgtg
atcgccgataatccggcgggtctttccgcgacgttgttctatctggtcgcctacagcttc
agcacgatgggtgcgtttgccatcgtgggtctggtccgaggcgccgacggctcagcaggt
tcagaggatgccgacctgtcccactgggccgggctgggacagcgttcacctatcgtgggc
gtgatgctgtcgatgtttctgctggccttcgccggcatcccgttgaccagtggattcgtc
agcaagttcgcggtgtttagggccgccgcttccgccggcgcggtgccgctggtaatcgtc
ggcgtgatctccagcggcgtcgccgcctacttctacgtgcgggtgatcgtgagcatgttc
ttcaccgaagaatccggtgacacaccacacgtggcggcacccggcgtgctgagcaaggcc
gccattgcggtatgcacggtagtcaccgtggtgctggggatcgccccgcagccggtgctc
gacctggccgaccaggccgcccagttgctgcgctga

DBGET integrated database retrieval system